DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and AT4G05470

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001319875.1 Gene:AT4G05470 / 825897 AraportID:AT4G05470 Length:306 Species:Arabidopsis thaliana


Alignment Length:321 Identity:70/321 - (21%)
Similarity:110/321 - (34%) Gaps:107/321 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EEEPEIKQRKREKEHKESLDRETECNLMDFCDELLFEIFQYLDTSSIL--AVMHCSPRFENLLLD 105
            |:|....::.......|||..:...|.:|...||...|...|..:.||  |...|. .:..:..|
plant    20 EDEEGRNKKTTTSTTLESLLMKERRNWVDLPPELTTSILLRLSLTDILDNAQKVCK-EWRRICKD 83

  Fly   106 HRFY--------------------HHIDLSNGPLPMGILE----------EILGRATEKTHTIKI 140
            ...:                    |.:|||.|    |:||          .:|...|:::..::.
plant    84 PSMWRKINTRDCLMYNFDFVSMCRHIVDLSQG----GLLEINVDEHFLSDSLLSYITDRSRNLRS 144

  Fly   141 CGPPSSQHVAGEFRQFTQTLSSVFPRVVQLKVLE-------LEG-------VSLDFEYI-HITEF 190
            .|                 |...||||.:|.|:.       ||.       :.||.:.| |..  
plant   145 LG-----------------LGMCFPRVTKLGVVNAIAKIPLLETLEVTHSCIKLDLKAIGHAC-- 190

  Fly   191 PATLRRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSL- 254
             ..|:.|||.... |:  .|.|..|...: |.|:..|..:|::      :.....:|.|..|.| 
plant   191 -PQLKTLKLNSLG-RL--WPASDKYDSNV-LDDMGPLECDDDA------LAIAESMPKLHHLQLM 244

  Fly   255 ------KGCQALCKFVPYGSMAARFGFQKLESLDLRQ----TPINNSDLQCFSAIENLKEL 305
                  .|..|:....|:           ||.||:|:    :.:.|.:.:|   :|.:|||
plant   245 ANRLTNTGLNAILDGCPH-----------LEHLDVRKCFRISLVGNLEKRC---LEMIKEL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 12/67 (18%)
leucine-rich repeat 610..635 CDD:275381
AT4G05470NP_001319875.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.