DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and AT2G14080

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_179024.1 Gene:AT2G14080 / 815893 AraportID:AT2G14080 Length:1215 Species:Arabidopsis thaliana


Alignment Length:741 Identity:149/741 - (20%)
Similarity:242/741 - (32%) Gaps:266/741 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ESLDRETECNLMDFCDELLFEI---FQYLDTSSILAV------MHCS----------------PR 98
            ||:::     |.||..:...:|   |..|...|::::      ||.|                |.
plant   491 ESIEK-----LEDFLGKTFLDIAQRFHVLAEKSLISINSNFVEMHDSLAQLGKEIVRKQSVREPG 550

  Fly    99 FENLLLDHRFYHHI---DLSNGPLPMGILEEI-----LGRATEKTHTIKICGPPSSQHVAGEFRQ 155
            ....|:|.|....:   |.:.|...:||..::     :...:||...    |..:.|.:.     
plant   551 QRQFLVDARDISEVLADDTAGGRSVIGIYLDLHRNDDVFNISEKAFE----GMSNLQFLR----- 606

  Fly   156 FTQTLSSVFPRVVQL--------KVLELEGVSLDFEYIHITEFPA-------------------- 192
             .:...::||.:|.|        :.|.|    ||:.|..:|.||:                    
plant   607 -VKNFGNLFPAIVCLPHCLTYISRKLRL----LDWMYFPMTCFPSKFNPEFLVELNMWGSKLEKL 666

  Fly   193 -----TLRRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKL------ 246
                 .||.||..|           :|.|  .:|.:|.|||...|  .|...:.|.|.|      
plant   667 WEEIQPLRNLKRMD-----------LFSS--KNLKELPDLSSATN--LEVLNLNGCSSLVELPFS 716

  Fly   247 ----PSLRRLSLKGCQALCKFVPYGSMAARFGFQKLESLDLRQTPINNSDLQC--FSAIENLKEL 305
                ..|.:|.|.||.:|                    |:|..:..|..:||.  ||..|||.||
plant   717 IGNATKLLKLELSGCSSL--------------------LELPSSIGNAINLQTIDFSHCENLVEL 761

  Fly   306 LLESPQILHSKQAVAKKNTNGNATD--EAASPQPDSLKVLSDDEPSTSRAAMEHLRAC----KVA 364
                            .::.||||:  |.......|||.|.....:.:.....||..|    ::.
plant   762 ----------------PSSIGNATNLKELDLSCCSSLKELPSSIGNCTNLKKLHLICCSSLKELP 810

  Fly   365 FNLDNCSDRKEEK----SPVPTEPPSEGQDLQ-AKRIRAPSESDDEDTSSTSGSSSDKLEVLSLP 424
            .::.||::.||..    |.:...|.|.|..:. .|.|.|..||..| ..|..|.::: |::|:| 
plant   811 SSIGNCTNLKELHLTCCSSLIKLPSSIGNAINLEKLILAGCESLVE-LPSFIGKATN-LKILNL- 872

  Fly   425 RNGHSNAAPLSGGVDLPPLPHAADAANAADAPIAVDAANIEAPGQSPGLDPRPPRAYIYVPDAEN 489
              |:     ||..|:||.                                        ::.:...
plant   873 --GY-----LSCLVELPS----------------------------------------FIGNLHK 890

  Fly   490 ANPRQQRSVVAVFAQGTEQRYIYVNQQFSLPMNV----------LMPTRRHRTHPR-PNYDQVVQ 543
            .:..:.|....:....|.     :|.:|...:::          ::.|...|.|.| ...::|..
plant   891 LSELRLRGCKKLQVLPTN-----INLEFLNELDLTDCILLKTFPVISTNIKRLHLRGTQIEEVPS 950

  Fly   544 HPMFWNMLEPLDRDYARRVRPRPPSCQTTPQYYVTDRAMYSFGRADRPVQPDVVWIRNINRSPDN 608
            ....|..||.|...|:..:         :...:|.:| :.....:|..::....|:..|.|    
plant   951 SLRSWPRLEDLQMLYSENL---------SEFSHVLER-ITVLELSDINIREMTPWLNRITR---- 1001

  Fly   609 KLERLSLRNYHLITNHTLEHLVQCSPNLVYIDVS--------GTSITLPAIR------RFKISKP 659
             |.||.|.....:.:     |.|.|.:|:.:|..        |.|...|.|:      ..|:.|.
plant  1002 -LRRLKLSGCGKLVS-----LPQLSDSLIILDAENCGSLERLGCSFNNPNIKCLDFTNCLKLDKE 1060

  Fly   660 KCEVV----ANHLEEFERLPELETQE 681
            ..:::    |.|   :..||..|..|
plant  1061 ARDLIIQATARH---YSILPSREVHE 1083

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 14/73 (19%)
leucine-rich repeat 610..635 CDD:275381 7/24 (29%)
AT2G14080NP_179024.1 PLN03210 52..1115 CDD:215633 149/741 (20%)
TIR 56..221 CDD:279864
AAA 256..374 CDD:99707
leucine-rich repeat 579..601 CDD:275380 3/25 (12%)
leucine-rich repeat 631..650 CDD:275381 8/22 (36%)
LRR_3 652..671 CDD:285026 0/18 (0%)
leucine-rich repeat 653..675 CDD:275380 1/21 (5%)
AMN1 674..830 CDD:187754 51/206 (25%)
leucine-rich repeat 676..698 CDD:275380 10/34 (29%)
leucine-rich repeat 699..722 CDD:275380 4/22 (18%)
leucine-rich repeat 723..746 CDD:275380 9/42 (21%)
leucine-rich repeat 747..770 CDD:275380 12/38 (32%)
leucine-rich repeat 771..794 CDD:275380 5/22 (23%)
leucine-rich repeat 795..818 CDD:275380 5/22 (23%)
leucine-rich repeat 819..842 CDD:275380 6/22 (27%)
leucine-rich repeat 843..866 CDD:275380 8/23 (35%)
leucine-rich repeat 891..934 CDD:275380 4/47 (9%)
leucine-rich repeat 958..1001 CDD:275381 9/52 (17%)
leucine-rich repeat 1002..1033 CDD:275381 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.