DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and FBXL18

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001308142.1 Gene:FBXL18 / 80028 HGNCID:21874 Length:801 Species:Homo sapiens


Alignment Length:736 Identity:139/736 - (18%)
Similarity:241/736 - (32%) Gaps:270/736 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NLMDFCDELLFEIFQYL-DTSSILAVMHCSPRFENLLLDHRFYHHI----DLSNGPLPMGILEEI 127
            :|:.|.||:|..|..:: .|..||.|.....:...|.||....|.:    |.......:..|.:.
Human    27 HLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKE 91

  Fly   128 LGRATEKTHTIKICG----PPSS-QHVAGEFRQFTQT-----------LSSVFPRVVQLKVLELE 176
            :||..::   :.:.|    |.|: :||| ..|...:.           ||.:...:..|:.|.::
Human    92 IGREIQQ---LSMAGCYWLPGSTVEHVA-RCRSLVKVNLSGCHLTSLRLSKMLSALQHLRSLAID 152

  Fly   177 GVSLDFEYIHI-TEFPATLRRLKLKDCSVRVGDTPKSIF----------YSIELHLLDLEDLS-I 229
             ||..|:...: :|..|||.|::         :..:::|          .|:|..||..|.|. .
Human   153 -VSPGFDASQLSSECKATLSRVR---------ELKQTLFTPSYGVVPCCTSLEKLLLYFEILDRT 207

  Fly   230 EDNSWFEPYYIMGLSKLPSLRRLSLKGCQALCKFVPYGSMAARFGFQKLESLDLR----QTPINN 290
            .:.:......::|.|.:|..:.|.          |.|..:|..:..|::..|.|.    :||.| 
Human   208 REGAILSGQLMVGQSNVPHYQNLR----------VFYARLAPGYINQEVVRLYLAVLSDRTPQN- 261

  Fly   291 SDLQCF-----------SAIENL-----KELLLESPQILHSKQAVAKKNTNGNATDEAASPQPDS 339
              |..|           .|.:||     :.::|::.|:       .|...||::.          
Human   262 --LHAFLISVPGSFAESGATKNLLDSMARNVVLDALQL-------PKSWLNGSSL---------- 307

  Fly   340 LKVLSDDEP---STSRAAM-------------EHLRACKVAFNLDNCSD--------RKEEKSPV 380
            |:.:..:.|   |.||..:             :.||:. .:.||..|..        ||.|    
Human   308 LQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGKDLRSL-ASLNLSGCVHCLSPDSLLRKAE---- 367

  Fly   381 PTEPPSEGQDLQAKRIRAPSESDDEDTS--STSGSSSDKLEVLSLPRNGHSNAAPLS-------- 435
                                  ||.|:|  .|..:|...|..|:|....|.::..|.        
Human   368 ----------------------DDIDSSILETLVASCCNLRHLNLSAAHHHSSEGLGRHLCQLLA 410

  Fly   436 -----GGVDLPPLPHAADAANAADAPIAVDAANIEAPGQSPGLDPRPPRAYIYVPDAENANPRQQ 495
                 ..:.| |:...||:|..||          .||.|                .|.:|.||..
Human   411 RLRHLRSLSL-PVCSVADSAPRAD----------RAPAQ----------------PAMHAVPRGF 448

  Fly   496 RSVVAVFAQGTEQRYIYVNQQFSLPMNVLMPTRRHRTHPRPNYDQVVQHP--MFWNM-------- 550
            ...|.|..|..                           |.|...|....|  :||::        
Human   449 GKKVRVGVQSC---------------------------PSPFSGQACPQPSSVFWSLLKNLPFLE 486

  Fly   551 -LEPLDRDYAR-------RVRPRPPSCQTTPQYYVTDRAMYSFGRADRPVQPDVVWIRNINRSPD 607
             ||.:..:::.       .:|...|.|.....  |.|..:.:.|:        :.::|::.    
Human   487 HLELIGSNFSSAMPRNEPAIRNSLPPCSRAQS--VGDSEVAAIGQ--------LAFLRHLT---- 537

  Fly   608 NKLERLSLRNYHLITNHTLEHL-VQC----SPNLVYIDVSGTSITLPA----------IRRFKIS 657
              |.:|.    .::|...|.:: :||    |.:|..:.:.|..:.:||          :|..::.
Human   538 --LAQLP----SVLTGSGLVNIGLQCQQLRSLSLANLGMMGKVVYMPALSDMLKHCKRLRDLRLE 596

  Fly   658 KPKCEVVANHLEEFERLPELE 678
            :|.....|...:...:.|.|:
Human   597 QPYFSANAQFFQALSQCPSLQ 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 14/50 (28%)
leucine-rich repeat 610..635 CDD:275381 7/29 (24%)
FBXL18NP_001308142.1 F-box-like 33..75 CDD:289689 12/41 (29%)
leucine-rich repeat 292..317 CDD:275381 6/41 (15%)
leucine-rich repeat 345..384 CDD:275381 12/65 (18%)
leucine-rich repeat 385..414 CDD:275381 5/28 (18%)
leucine-rich repeat 415..484 CDD:275381 23/122 (19%)
leucine-rich repeat 451..476 CDD:275381 7/51 (14%)
leucine-rich repeat 485..532 CDD:275381 8/56 (14%)
leucine-rich repeat 533..559 CDD:275381 7/35 (20%)
leucine-rich repeat 560..589 CDD:275381 5/28 (18%)
leucine-rich repeat 590..615 CDD:275381 3/24 (13%)
leucine-rich repeat 616..640 CDD:275381 1/2 (50%)
GVQW 763..>779 CDD:290611
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.