DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and lrrc29

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_001339819.4 Gene:lrrc29 / 799466 ZFINID:ZDB-GENE-030131-7165 Length:644 Species:Danio rerio


Alignment Length:495 Identity:109/495 - (22%)
Similarity:160/495 - (32%) Gaps:186/495 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LDRETECNLMDFCDELLFEIFQYLDTSSI-----LAV-MHCSPRFENLLLDHRFYHHIDLSNGPL 119
            |.|...|.|          :..:||.||:     |.| :|..||.::|.          |....:
Zfish    63 LARHPRCGL----------VISHLDGSSVSRQVLLEVGLHLGPRLDSLA----------LPGSSI 107

  Fly   120 PMGILEEILGRATEKTHTIKICGPPSSQHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSL--DF 182
            ....|.|:|.|.| ....:.:.| ..|..::|.|....:....|:..::.|:.|.|..:..  |.
Zfish   108 TESCLLELLPRLT-SLRKLDLQG-LDSLFMSGAFLSREEHRRKVYRALLNLEELNLSNLRYLSDL 170

  Fly   183 EYIHITEFPATLRRLKLKDCSV------------------------------------------R 205
            .:..:|.....||||.|..|.:                                          |
Zfish   171 SFNRLTICTPGLRRLSLSGCHISFEFDPYRGCPVGSGSSALVSLRNLLNLLQKQTSTLRSLDLSR 235

  Fly   206 VGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKLPS-LRRLSLKGCQAL-CKFVPYGS 268
            .|.||||:....:|..|.||:|::........|.|..|.|..| ||.|.|.||..| |:.|    
Zfish   236 TGITPKSLRSISKLRGLRLEELNLHGCKELTDYSIEILCKYQSGLRMLDLSGCMELSCRAV---- 296

  Fly   269 MAARFGFQKLESLDLRQT-PINNSDLQCFSAIENLKELLLESPQILHSKQAVAKKNTNGNATDEA 332
            :|.....::|..|...|. .|.:..|.....:.:|:.|.|.  :.||         .:|.     
Zfish   297 LAVGAELKELRVLSFSQDWKITDKGLAELMMLPHLRSLDLS--ECLH---------VSGT----- 345

  Fly   333 ASPQPDSLKVLSDDEPSTSRAAME--HLRAC-----KVAF-------------NLDNC------- 370
                 :.:|.||..||   ||.:|  .||.|     .|.|             :|.:|       
Zfish   346 -----ELVKGLSGPEP---RAQVETLSLRNCTYIRDSVVFSLAQLLGVHLRELDLSSCVYLTDLS 402

  Fly   371 ---------------------------------------SDRKEEKSPVPT---------EPPS- 386
                                                   |||:|:|.|..|         :||| 
Zfish   403 VRAIATFLPALLVLRLGWCKEISDWGLLGMTEPTKHCQPSDREEDKGPSFTRTFGNMGFFQPPSL 467

  Fly   387 EGQDLQAKRIRAPSESDDEDTSSTSGSS---SDKLEVLSL 423
            ..||    :.|..::.|.|:.....|:|   ..:|:||.|
Zfish   468 PFQD----KPRLVTDEDLEEFRDQQGASLLALRELQVLEL 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 11/51 (22%)
leucine-rich repeat 610..635 CDD:275381
lrrc29XP_001339819.4 F-box-like 4..49 CDD:289689
leucine-rich repeat 71..96 CDD:275381 8/34 (24%)
leucine-rich repeat 97..121 CDD:275381 7/34 (21%)
leucine-rich repeat 122..179 CDD:275381 10/57 (18%)
leucine-rich repeat 182..227 CDD:275381 6/44 (14%)
AMN1 215..427 CDD:187754 52/239 (22%)
leucine-rich repeat 228..253 CDD:275381 7/24 (29%)
leucine-rich repeat 254..277 CDD:275381 7/22 (32%)
leucine-rich repeat 280..305 CDD:275381 10/28 (36%)
leucine-rich repeat 306..325 CDD:275381 5/18 (28%)
leucine-rich repeat 331..359 CDD:275381 12/51 (24%)
leucine-rich repeat 360..386 CDD:275381 6/25 (24%)
leucine-rich repeat 387..412 CDD:275381 2/24 (8%)
leucine-rich repeat 413..497 CDD:275381 17/87 (20%)
AMN1 <498..613 CDD:187754 4/6 (67%)
leucine-rich repeat 498..522 CDD:275381 4/6 (67%)
leucine-rich repeat 523..548 CDD:275381
leucine-rich repeat 549..574 CDD:275381
leucine-rich repeat 575..598 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.