Sequence 1: | NP_651593.1 | Gene: | CG5003 / 43344 | FlyBaseID: | FBgn0039554 | Length: | 713 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_780415.1 | Gene: | Fbxl22 / 74165 | MGIID: | 1921415 | Length: | 236 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 42/204 - (20%) |
---|---|---|---|
Similarity: | 71/204 - (34%) | Gaps: | 62/204 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 198 KLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIED--------------NSWFEPYYIMGLSKLPS 248
Fly 249 LRRLSLKGCQALCKFVPYGSMAARFGFQKLESLDLRQTPINNSDLQCFSAIENLKELLLESPQIL 313
Fly 314 HSKQAVAKKNTNGNATDEAASPQPDSLKVLSDDE-PSTSRAAMEHLR-ACKVAFNLDNCSDRKEE 376
Fly 377 KSPVPTEPP 385 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5003 | NP_651593.1 | F-box | 68..114 | CDD:279040 | |
leucine-rich repeat | 610..635 | CDD:275381 | |||
Fbxl22 | NP_780415.1 | F-box-like | 3..43 | CDD:403981 | |
LRR 1 | 15..40 | ||||
LRR 2 | 43..72 | 6/20 (30%) | |||
AMN1 | 45..>200 | CDD:187754 | 38/190 (20%) | ||
LRR 3 | 98..123 | 4/24 (17%) | |||
leucine-rich repeat | 116..141 | CDD:275381 | 9/61 (15%) | ||
LRR 4 | 124..149 | 7/61 (11%) | |||
leucine-rich repeat | 142..167 | CDD:275381 | 4/26 (15%) | ||
LRR 5 | 150..175 | 6/26 (23%) | |||
leucine-rich repeat | 168..193 | CDD:275381 | 9/27 (33%) | ||
LRR 6 | 176..201 | 9/29 (31%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167843093 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR16134 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |