| Sequence 1: | NP_651593.1 | Gene: | CG5003 / 43344 | FlyBaseID: | FBgn0039554 | Length: | 713 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006534361.1 | Gene: | Fbxl20 / 72194 | MGIID: | 1919444 | Length: | 438 | Species: | Mus musculus |
| Alignment Length: | 432 | Identity: | 90/432 - (20%) |
|---|---|---|---|
| Similarity: | 141/432 - (32%) | Gaps: | 149/432 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 75 ELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGRATEKTHTIK 139
Fly 140 ICG----PPSSQHVAG----EFRQFTQTLSSVFPRVVQLKVLELEGV--SLDFEYIHITEFPATL 194
Fly 195 RRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKL----PSLRRLSLK 255
Fly 256 GC-----------------------QALCKFVPYGSMAARFGFQKLESLDLRQTPINNSDLQCFS 297
Fly 298 AIENLKELLLES-----PQILHSKQAVAKKNTNGNATDEAAS----------------------- 334
Fly 335 ----PQ--------------------------PDSLKVLS-DDEPSTSRAAMEHLRACK--VAFN 366
Fly 367 LDNC-----SDRKEEKSPVP-----------TEPPSEGQDLQ 392 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5003 | NP_651593.1 | F-box | 68..114 | CDD:279040 | 12/38 (32%) |
| leucine-rich repeat | 610..635 | CDD:275381 | |||
| Fbxl20 | XP_006534361.1 | F-box-like | 30..71 | CDD:403981 | 11/37 (30%) |
| leucine-rich repeat | 67..94 | CDD:275381 | 10/34 (29%) | ||
| AMN1 | 95..291 | CDD:187754 | 46/222 (21%) | ||
| leucine-rich repeat | 95..114 | CDD:275381 | 3/18 (17%) | ||
| leucine-rich repeat | 121..146 | CDD:275381 | 6/31 (19%) | ||
| leucine-rich repeat | 147..172 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 173..198 | CDD:275381 | 8/27 (30%) | ||
| leucine-rich repeat | 199..224 | CDD:275381 | 6/24 (25%) | ||
| AMN1 | 222..396 | CDD:187754 | 29/186 (16%) | ||
| leucine-rich repeat | 225..250 | CDD:275381 | 3/24 (13%) | ||
| leucine-rich repeat | 251..276 | CDD:275381 | 7/37 (19%) | ||
| leucine-rich repeat | 277..302 | CDD:275381 | 4/24 (17%) | ||
| leucine-rich repeat | 303..328 | CDD:275381 | 0/24 (0%) | ||
| leucine-rich repeat | 329..357 | CDD:275381 | 0/27 (0%) | ||
| leucine-rich repeat | 358..382 | CDD:275381 | 9/23 (39%) | ||
| leucine-rich repeat | 383..408 | CDD:275381 | 3/24 (13%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167843139 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1046098at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.850 | |||||