DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Fbxl18

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_006248969.1 Gene:Fbxl18 / 678726 RGDID:1596958 Length:707 Species:Rattus norvegicus


Alignment Length:733 Identity:137/733 - (18%)
Similarity:229/733 - (31%) Gaps:277/733 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ECNLMDFCDELLFEIFQYL-DTSSILAVMHCSPRFENLLLDHRFYHHI----DLSNGPLPMGILE 125
            :.:|:.|.||:|..|..:: .|..:|.|.....:...|.||....|.:    |.......:..|.
  Rat    14 DTHLLGFSDEILLHILSHVPSTDLVLNVRRTCRKLAALCLDKSLVHTVLLQKDYQASEEKVKQLV 78

  Fly   126 EILGRATEKTHTIKICGPPSS--QHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSLDFEYIHIT 188
            :.:||..::.:.......|.|  :|||               |...|..:.|.|       .|:|
  Rat    79 KEIGREIQQLNMAGCYWLPGSTIEHVA---------------RCHSLVKVNLSG-------CHLT 121

  Fly   189 EFPATLRRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLS 253
                :||..::..|..|                  |..|:|:.:..|:      .|:|.|..:.:
  Rat   122 ----SLRLSRVLSCLQR------------------LRSLAIDVSPGFD------ASQLSSECKAT 158

  Fly   254 LKGCQALCK--FVP-YGSMAARFGFQKLESLDLRQTPINNSDLQCFSAIENLKELLLESPQILHS 315
            |...|.|.:  |.| ||.:......|||              |..|..::..:|..:.|.|::  
  Rat   159 LSRVQELKQTLFTPSYGVVPCCASLQKL--------------LLYFEILDRTREGAVLSGQLM-- 207

  Fly   316 KQAVAKKNTNGNATDEAASPQPDSLKVLSDDEPSTSRAAMEHLRACKVAFNLDNCSDRKEEKSPV 380
               |.:.|.          |...:|:|.      .:|.|..::....|...|...|||..|    
  Rat   208 ---VGQSNV----------PHYQNLRVF------YARLAPGYINQEVVRLYLAVLSDRTPE---- 249

  Fly   381 PTEPPSEGQDLQAKRIRAP---SESDDEDTSSTSGSSSDKLEVLSLPRN---------------- 426
                     :|.|..|..|   :||........|.:.:..|:.|.||::                
  Rat   250 ---------NLHAFLISVPGSFAESGATKNLLDSMARNVALDALQLPKSWLNGSTLLQHMKFNNP 305

  Fly   427 ------------GHSNAAPLSGGVDLPPLP------------------HAADAANAADAPIAVDA 461
                        ||.....::||.||..|.                  .|.|..:::.....|::
  Rat   306 FYFSFSRCTLSGGHLIQRLINGGKDLRSLASLNLSGCVHCLSADSLLRKAEDDIDSSILETLVES 370

  Fly   462 A------NIEAP--GQSPGLD---------------------------PRPPRAYIYVPDAENAN 491
            .      |:.|.  ..|.||.                           |||.||  ..|.|.:|.
  Rat   371 CCNLHHLNLSAAHHHSSDGLGRHLCQLLARLCHLRSLSLPVCSVADSAPRPDRA--PAPPAMHAV 433

  Fly   492 PRQQRSVVAVFAQGTEQRYIYVNQQFSLPMNVLMPTRRHRTHPRPNYDQVVQHP--MFWNM---- 550
            ||.....|.:..|                           |.|.|...|....|  :||::    
  Rat   434 PRGFGKKVRIGVQ---------------------------TCPNPFVGQSAPQPASVFWSLLKKL 471

  Fly   551 -----LEPLDRDYAR-------RVRPRPPSCQTTPQYYVTDRAMYSFGRADRPVQPDVVWIRNIN 603
                 ||.:..:::.       .:|...|.|.....  |.|..:.:.|:        :.::|::.
  Rat   472 PFLEHLELIGSNFSSAMPRNEPAIRNSLPPCSRAQN--VGDSEVAAIGQ--------LTFLRHLT 526

  Fly   604 RSPDNKLERLSLRNYHLITNHTLEHL-VQC----SPNLVYIDVSGTSITLPAIRRFKISKPKCEV 663
                  |.:|.    .::|...|..: :||    |.:|..:.:.|..:.:||:            
  Rat   527 ------LAQLP----GMLTGSGLVSIGLQCQQLQSLSLANLGMMGKVVYMPAL------------ 569

  Fly   664 VANHLEEFERLPELETQE 681
             |:.|:..:||.:|..::
  Rat   570 -ADMLKHCKRLKDLRLEQ 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 13/50 (26%)
leucine-rich repeat 610..635 CDD:275381 7/29 (24%)
Fbxl18XP_006248969.1 F-box-like 22..64 CDD:289689 11/41 (27%)
leucine-rich repeat 334..373 CDD:275381 4/38 (11%)
leucine-rich repeat 374..403 CDD:275381 5/28 (18%)
leucine-rich repeat 404..473 CDD:275381 19/97 (20%)
leucine-rich repeat 522..548 CDD:275381 7/35 (20%)
leucine-rich repeat 549..578 CDD:275381 7/41 (17%)
leucine-rich repeat 579..604 CDD:275381 2/8 (25%)
leucine-rich repeat 605..629 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346608
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.