DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and SKP2

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_005974.2 Gene:SKP2 / 6502 HGNCID:10901 Length:424 Species:Homo sapiens


Alignment Length:330 Identity:73/330 - (22%)
Similarity:110/330 - (33%) Gaps:89/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LAAPKRRFPDNERCGRELAAVPVQPVLPQIPTEEEPEIKQRKREKEHKESLD----RETECNLMD 71
            ::|.::..||:|...:||           :.....||...|||.|......|    |..:.|..:
Human    38 VSALEKEEPDSENIPQEL-----------LSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNREN 91

  Fly    72 F--------CDELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEIL 128
            |        .||||..||..|....:|.|.....|:..|..|...:..:||:...|...:...:|
Human    92 FPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLL 156

  Fly   129 GRATEKTHTIKICGPPS--SQHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSLDFEYIHITEFP 191
            .:.     .|....|.|  .|.:|..|..|......:...|::  |..|.|:             
Human   157 SQG-----VIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIE--VSTLHGI------------- 201

  Fly   192 ATLRRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSLKG 256
                   |..||              :|..|.||.|.:.|.      .:..|:|..:|.||:|.|
Human   202 -------LSQCS--------------KLQNLSLEGLRLSDP------IVNTLAKNSNLVRLNLSG 239

  Fly   257 CQALCKFVPYGSMAARFGFQKLESLDLRQTPINNSDLQCFSAIENLKELLLESPQILHSKQAVAK 321
            |...          :.|..|.|.|...|...:|.|  .||...|...::     .:.|..:.:.:
Human   240 CSGF----------SEFALQTLLSSCSRLDELNLS--WCFDFTEKHVQV-----AVAHVSETITQ 287

  Fly   322 KNTNG 326
            .|.:|
Human   288 LNLSG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 14/53 (26%)
leucine-rich repeat 610..635 CDD:275381
SKP2NP_005974.2 Mediates interaction with hepatitis C virus non-structural protein NS5A. /evidence=ECO:0000269|PubMed:27194766 1..220 51/233 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..73 12/44 (27%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:22770219 67..73 4/5 (80%)
F-box-like 97..141 CDD:403981 12/43 (28%)
leucine-rich repeat 183..207 CDD:275381 7/59 (12%)
AMN1 193..>345 CDD:187754 33/159 (21%)
leucine-rich repeat 208..231 CDD:275381 8/28 (29%)
LRR 3. /evidence=ECO:0000269|PubMed:11099048 210..234 8/29 (28%)
leucine-rich repeat 232..257 CDD:275381 10/34 (29%)
LRR 4. /evidence=ECO:0000269|PubMed:11099048 235..257 8/31 (26%)
leucine-rich repeat 258..284 CDD:275381 6/32 (19%)
LRR 5. /evidence=ECO:0000269|PubMed:11099048 258..284 6/32 (19%)
leucine-rich repeat 285..311 CDD:275381 2/8 (25%)
LRR 6. /evidence=ECO:0000269|PubMed:11099048 286..308 2/7 (29%)
LRR 7. /evidence=ECO:0000269|PubMed:11099048 309..330
leucine-rich repeat 312..336 CDD:275381
LRR 8. /evidence=ECO:0000269|PubMed:11099048 334..356
leucine-rich repeat 337..356 CDD:275381
LRR 9. /evidence=ECO:0000269|PubMed:11099048 359..378
leucine-rich repeat 365..392 CDD:275381
LRR 10. /evidence=ECO:0000269|PubMed:11099048 380..401
Mediates interaction with IFI27. /evidence=ECO:0000269|PubMed:27194766 402..424
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152994
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.