DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and FBXL17

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_005272105.1 Gene:FBXL17 / 64839 HGNCID:13615 Length:712 Species:Homo sapiens


Alignment Length:393 Identity:80/393 - (20%)
Similarity:142/393 - (36%) Gaps:117/393 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AAPKRRFPDNERCGRELAAVPVQPVL--PQIPTEE----------------EPEIKQRKRE---K 55
            |:|.|. ||...|  :....|.||:.  |..||.|                .|...|::.|   .
Human   237 ASPPRP-PDAGCC--QAPEQPPQPLCPPPSSPTSEGAPTEAGGDAVRAGGTAPLSAQQQHECGDA 298

  Fly    56 EHKESLDRETEC---------NLMDFCDELLFEIFQ--YLDTSSILAVMHCSPRFENLLLDHRFY 109
            :.:||.:...:|         ::......:|.:||.  .||...:.|.:.|. .:.:|.||.:|:
Human   299 DCRESPENPCDCHREPPPETPDINQLPPSILLKIFSNLSLDERCLSASLVCK-YWRDLCLDFQFW 362

  Fly   110 HHIDLSNGPLPMGILEEILGRATEKTHTI--------------KIC-----GPPSSQHVAGEFRQ 155
            ..:|||:   ...:.:|:|.:...::..|              .:|     .|...::.|...:|
Human   363 KQLDLSS---RQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAYRCKQ 424

  Fly   156 FTQT----LSSVFPRVVQLKV-----LELEGVSLDFEYIHITEFPATLRRLK---LKDCSVRVGD 208
            .:.|    ::|..|.:.::.|     |..||         :.:..:..|.||   ...| .::.|
Human   425 LSDTSIIAVASHCPLLQKVHVGNQDKLTDEG---------LKQLGSKCRELKDIHFGQC-YKISD 479

  Fly   209 TPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSK-LPSLRRLSLKGCQALCKFVPYGSMAAR 272
            ....:   |....|.|:.:.:::|.......:...:: .|.|:.:...||....|.|.:.:.   
Human   480 EGMIV---IAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTK--- 538

  Fly   273 FGFQKLESLDLRQ-TPINNSDL-----------------------QCFSAI----ENLKELLLES 309
              .:.|.|||||. |.::|..:                       :|...|    :|||||.|.|
Human   539 --LRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVS 601

  Fly   310 PQI 312
            .:|
Human   602 CKI 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 11/47 (23%)
leucine-rich repeat 610..635 CDD:275381
FBXL17XP_005272105.1 F-box-like 321..368 CDD:289689 12/47 (26%)
leucine-rich repeat 362..387 CDD:275381 5/27 (19%)
leucine-rich repeat 388..413 CDD:275381 2/24 (8%)
AMN1 411..573 CDD:187754 33/179 (18%)
leucine-rich repeat 414..439 CDD:275381 4/24 (17%)
leucine-rich repeat 440..465 CDD:275381 4/33 (12%)
leucine-rich repeat 466..491 CDD:275381 5/28 (18%)
leucine-rich repeat 492..517 CDD:275381 2/24 (8%)
leucine-rich repeat 518..541 CDD:275381 5/27 (19%)
leucine-rich repeat 542..567 CDD:275381 8/24 (33%)
AMN1 547..>652 CDD:187754 14/58 (24%)
leucine-rich repeat 568..593 CDD:275381 2/24 (8%)
leucine-rich repeat 594..615 CDD:275381 7/11 (64%)
leucine-rich repeat 619..641 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153038
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.