DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and fbxl7

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001073511.1 Gene:fbxl7 / 569430 ZFINID:ZDB-GENE-061215-122 Length:489 Species:Danio rerio


Alignment Length:383 Identity:73/383 - (19%)
Similarity:136/383 - (35%) Gaps:116/383 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGR-------- 130
            |....:||.:|.|:.:........|:.||..|.|.:..|.|:...|.:.....:|.|        
Zfish   117 DHAFLQIFTHLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGDVLHVDRALRVLTRRLCQDTPN 181

  Fly   131 --ATEKTHTIKICGPPSSQ---------------HVAGEFRQFTQTLSSVFPRVVQLKVLELEG- 177
              .|.:|..:..|...:.:               .|||.:....:.:..|..|...|:.|::.| 
Zfish   182 VCLTVETVMVSGCRRLTDRGLYTVAQSCPELRRLEVAGCYNVSNEAVFEVVSRCPNLEHLDVSGC 246

  Fly   178 -----------VSLDFEYIHITEFPATLRRLKLKDC-------------------------SVRV 206
                       ||:....:|..:.  ::|.|.:.||                         .||:
Zfish   247 SKVTCISLTRDVSVKLSPLHGQQI--SIRFLDMTDCFALEDEGLHTIAAHCTQLTHLYLRRCVRL 309

  Fly   207 GDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKLPS----------------------- 248
              |.:.:.:.: ::...:.:||:.|..:...:.:..::||..                       
Zfish   310 --TDEGLRFLV-IYCPGVRELSVSDCRFISDFGLREIAKLEGRLRYLSIAHCSRITDVGVRYVAK 371

  Fly   249 ----LRRLSLKGCQALCKFVPYGSMAARFGFQKLESLDLRQTP-INNSDLQCFSAIE-NLKELLL 307
                ||.|:.:||:.|   ..:|.........||:|||:.:.| ::::.|:..:... |||.|.|
Zfish   372 YCSRLRYLNARGCEGL---TDHGIEHLAKSCLKLKSLDIGKCPLVSDAGLEQLALNSFNLKRLSL 433

  Fly   308 ESPQILHSK--QAVAKKNTNGNATDEAASPQPDSLKVLSDDEPSTSRAAMEHL-RACK 362
            :|.:.:..:  |.||     .|..|         |::|:..:...|..|:..: |.||
Zfish   434 KSCESITGRGLQVVA-----ANCFD---------LQLLNVQDCDVSLEALRFVKRHCK 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 11/39 (28%)
leucine-rich repeat 610..635 CDD:275381
fbxl7NP_001073511.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76
F-box-like 112..158 CDD:289689 11/40 (28%)
leucine-rich repeat 127..151 CDD:275381 6/23 (26%)
leucine-rich repeat 152..185 CDD:275381 5/32 (16%)
LRR 1 168..193 4/24 (17%)
AMN1 <183..364 CDD:187754 26/185 (14%)
leucine-rich repeat 186..211 CDD:275381 2/24 (8%)
LRR 2 194..219 2/24 (8%)
leucine-rich repeat 212..233 CDD:275381 4/20 (20%)
LRR 3 220..245 4/24 (17%)
leucine-rich repeat 238..271 CDD:275381 6/34 (18%)
LRR 4 251..279 5/29 (17%)
leucine-rich repeat 272..297 CDD:275381 4/24 (17%)
LRR 5 280..305 1/24 (4%)
AMN1 295..463 CDD:187754 35/187 (19%)
leucine-rich repeat 298..323 CDD:275381 3/27 (11%)
LRR 6 306..331 5/27 (19%)
leucine-rich repeat 324..349 CDD:275381 5/24 (21%)
LRR 7 332..357 2/24 (8%)
leucine-rich repeat 350..375 CDD:275381 0/24 (0%)
LRR 8 358..383 3/24 (13%)
leucine-rich repeat 376..401 CDD:275381 7/27 (26%)
LRR 9 384..409 8/27 (30%)
leucine-rich repeat 402..427 CDD:275381 6/24 (25%)
LRR 10 410..435 7/24 (29%)
leucine-rich repeat 428..451 CDD:275381 8/27 (30%)
LRR 11 436..461 7/38 (18%)
leucine-rich repeat 454..478 CDD:275381 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.