DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and FBXL12

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_016882401.1 Gene:FBXL12 / 54850 HGNCID:13611 Length:343 Species:Homo sapiens


Alignment Length:206 Identity:48/206 - (23%)
Similarity:76/206 - (36%) Gaps:50/206 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SSILAVMHCSPRFENLLLDHRF-------YHHIDLSN----GP-----LPMG------------I 123
            |...|.|..:....||:..|.|       ..|.|...    ||     ||.|            :
Human    11 SRFSATMSSNSSALNLVKPHFFEIGSACRRDHGDFGRTAGLGPARDLLLPPGTGPDPHLQMRPKV 75

  Fly   124 LEEILGR-ATEKTHTIKICGPPSSQHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSL---DFEY 184
            :..:|.| ...:.|::::.|...|...|.:       ||....|.:..|...|:.:.|   |...
Human    76 MWHLLRRYMASRLHSLRMGGYLFSGSQAPQ-------LSPALLRALGQKCPNLKRLCLHVADLSM 133

  Fly   185 IHITEFPATLRRLKLKDCSVRVGDTPK----SIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSK 245
            :.||..|:|||.|:|..|.:.:....|    ::...:|..:||....       |...::.||::
Human   134 VPITSLPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPA-------FRDEHLQGLTR 191

  Fly   246 LPSLRRLSLKG 256
            ..:||.|.|.|
Human   192 FRALRSLVLGG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 8/33 (24%)
leucine-rich repeat 610..635 CDD:275381
FBXL12XP_016882401.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 1 1.000 - - FOG0009915
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5688
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.