DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and FBXL19

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001093254.2 Gene:FBXL19 / 54620 HGNCID:25300 Length:694 Species:Homo sapiens


Alignment Length:447 Identity:93/447 - (20%)
Similarity:148/447 - (33%) Gaps:132/447 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 PQILHSKQAVAKKNTNGNATDEAASPQPD--SLKVLSDDEPSTSRAAMEHL-RACKVAFNLDNCS 371
            |::|:..||.:..:. |...:....|:|.  |.:..:...||..|..:|.. |.|::   |:...
Human   261 PRVLNPSQAFSSCHP-GLPPENWEKPKPPLASAEGPAVPSPSPQREKLERFKRMCQL---LERVP 321

  Fly   372 DRKEEKSPVPTEPPSEGQDLQAKRIRAPSESDDEDTSSTSGSSSDKLEVLSLPRNGHSNAAPLSG 436
            |.....|...::..|.|..|...  .||.|:.: ......|||.:|..     |.|.....|.||
Human   322 DTSSSSSDSDSDSDSSGTSLSED--EAPGEARN-GRRPARGSSGEKEN-----RGGRRAVRPGSG 378

  Fly   437 GVDLP-PLPHAADAANAADAPIAVDAANIEAPGQSPGLDPRPPRAYIYVPDAENANPRQQRSVVA 500
            |..|. ||                          .|...||||:...:|   ....||.......
Human   379 GPLLSWPL--------------------------GPAPPPRPPQLERHV---VRPPPRSPEPDTL 414

  Fly   501 VFAQGTEQ-----RYIYVNQQFSLPMNVLMPTRRHRTHPRPNYDQVVQHPMFWNMLEPLDRDYAR 560
            ..|.|::.     .::.|.|... |..:.:..|..||..|..||:     ..|..:     |.:|
Human   415 PLAAGSDHPLPRAAWLRVFQHLG-PRELCICMRVCRTWSRWCYDK-----RLWPRM-----DLSR 468

  Fly   561 RVRPRPPS----CQTTPQ--------------YYVTDR---------------AMYSFGRADRPV 592
            |....||.    .:..|:              .::.:|               ::.:.|.|..|.
Human   469 RKSLTPPMLSGVVRRQPRALDLSWTGVSKKQLMWLLNRLQGLQELVLSGCSWLSVSALGSAPLPA 533

  Fly   593 QP--DVVWIRNINRS---------PDNK------------LERLSLRNYHLITNHTLEHLVQCSP 634
            ..  |:.||.::..|         ||.|            :..|.|....| |:.:|..|::.:|
Human   534 LRLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLEL-TDASLRLLLRHAP 597

  Fly   635 NLVYIDVSGTS---------ITLPA--IRR--FKISKPKCEVVANH-LEEFERLPEL 677
            .|..:|:|..:         :|.|.  :|.  ..::...|..:.:| |..|.|.|.|
Human   598 QLSALDLSHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCPRL 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040
leucine-rich repeat 610..635 CDD:275381 6/24 (25%)
FBXL19NP_001093254.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
zf-CXXC <50..77 CDD:251032
PHD_FXL19 87..148 CDD:277115
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..420 45/199 (23%)
F-box-like 424..465 CDD:315592 10/51 (20%)
leucine-rich repeat 461..485 CDD:275381 6/28 (21%)
AMN1 466..665 CDD:332986 36/190 (19%)
leucine-rich repeat 486..508 CDD:275381 1/21 (5%)
LRR 1 492..517 1/24 (4%)
leucine-rich repeat 510..533 CDD:275381 2/22 (9%)
LRR 2 518..541 4/22 (18%)
leucine-rich repeat 534..573 CDD:275381 7/38 (18%)
leucine-rich repeat 574..598 CDD:275381 6/24 (25%)
LRR 3 581..606 7/25 (28%)
leucine-rich repeat 599..623 CDD:275381 5/23 (22%)
LRR 4 607..636 3/28 (11%)
leucine-rich repeat 629..653 CDD:275381 5/23 (22%)
LRR 5 637..661 7/18 (39%)
leucine-rich repeat 654..686 CDD:275381 1/1 (100%)
LRR 6 662..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.