DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and fbxl22

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001013297.1 Gene:fbxl22 / 503591 ZFINID:ZDB-GENE-050227-1 Length:227 Species:Danio rerio


Alignment Length:75 Identity:21/75 - (28%)
Similarity:38/75 - (50%) Gaps:3/75 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   609 KLERLSLRNYHLITNHTLEHLVQCSPNLVYIDVS-GTSITLPAIRRFKISKPKCEVVANHLEEFE 672
            :|..|||.|...||:..|:..|:...||..:.|. ..::|...::..|..||  ||:.:.|...:
Zfish   141 RLRSLSLENCARITDSVLKAAVEHGHNLTEVRVDFCRNVTQAGLQELKNKKP--EVLLSALHSAD 203

  Fly   673 RLPELETQEE 682
            .:|:.:.:|:
Zfish   204 MIPDCKPEEK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040
leucine-rich repeat 610..635 CDD:275381 9/24 (38%)
fbxl22NP_001013297.1 F-box-like 9..48 CDD:289689
AMN1 <103..>191 CDD:187754 14/49 (29%)
leucine-rich repeat 116..141 CDD:275381 21/75 (28%)
leucine-rich repeat 142..167 CDD:275381 9/24 (38%)
leucine-rich repeat 168..187 CDD:275381 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.