powered by:
Protein Alignment CG5003 and fbxl22
DIOPT Version :9
Sequence 1: | NP_651593.1 |
Gene: | CG5003 / 43344 |
FlyBaseID: | FBgn0039554 |
Length: | 713 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001013297.1 |
Gene: | fbxl22 / 503591 |
ZFINID: | ZDB-GENE-050227-1 |
Length: | 227 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 21/75 - (28%) |
Similarity: | 38/75 - (50%) |
Gaps: | 3/75 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 609 KLERLSLRNYHLITNHTLEHLVQCSPNLVYIDVS-GTSITLPAIRRFKISKPKCEVVANHLEEFE 672
:|..|||.|...||:..|:..|:...||..:.|. ..::|...::..|..|| ||:.:.|...:
Zfish 141 RLRSLSLENCARITDSVLKAAVEHGHNLTEVRVDFCRNVTQAGLQELKNKKP--EVLLSALHSAD 203
Fly 673 RLPELETQEE 682
.:|:.:.:|:
Zfish 204 MIPDCKPEEK 213
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170587996 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.