DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and fbxl3b

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001006075.1 Gene:fbxl3b / 450055 ZFINID:ZDB-GENE-041010-178 Length:162 Species:Danio rerio


Alignment Length:40 Identity:12/40 - (30%)
Similarity:20/40 - (50%) Gaps:4/40 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EPEIKQRKREKEHKESLDRETECNLMDFCDELLFEIFQYL 84
            :||:.:|.|    .:|.|.:...:......|:|.:|.|||
Zfish    19 DPELCKRLR----CDSEDGDGPVDWGQLPQEILLQILQYL 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 6/17 (35%)
leucine-rich repeat 610..635 CDD:275381
fbxl3bNP_001006075.1 F-box-like 39..80 CDD:289689 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.