powered by:
Protein Alignment CG5003 and fbxl3b
DIOPT Version :9
Sequence 1: | NP_651593.1 |
Gene: | CG5003 / 43344 |
FlyBaseID: | FBgn0039554 |
Length: | 713 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001006075.1 |
Gene: | fbxl3b / 450055 |
ZFINID: | ZDB-GENE-041010-178 |
Length: | 162 |
Species: | Danio rerio |
Alignment Length: | 40 |
Identity: | 12/40 - (30%) |
Similarity: | 20/40 - (50%) |
Gaps: | 4/40 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 EPEIKQRKREKEHKESLDRETECNLMDFCDELLFEIFQYL 84
:||:.:|.| .:|.|.:...:......|:|.:|.|||
Zfish 19 DPELCKRLR----CDSEDGDGPVDWGQLPQEILLQILQYL 54
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR16134 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.