DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and CG12402

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster


Alignment Length:402 Identity:93/402 - (23%)
Similarity:148/402 - (36%) Gaps:116/402 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ESLDRETECNLMDF-CDELLFE-------IFQYLDTSSILAVMHCSPRF----ENLLLDHRFYH- 110
            :.||.:...:|:.| ||.:..:       :.|...|.:.:.:.|....|    ||.|||....| 
  Fly   209 DDLDMKQFSHLVGFECDGVSLDAVLKMRMLLQLRRTENKVQLRHLQFEFRRNNENALLDVLQDHA 273

  Fly   111 ------HIDLSNGPLPMGILEEILGRATEKTH---TIKICG--------------PPSSQ----- 147
                  ::..|..|   ||......||.|..|   |:|:.|              |.|:.     
  Fly   274 ETLVCVNLFFSCSP---GIDTREWCRAFENMHNLRTLKLSGNCHLVLLEAVLRAVPESAPIRQLD 335

  Fly   148 -------------HVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSLDFEYIHITEFPATLRRLKL 199
                         :|||:::...:.|..:|  .|||....::.         :.:....|..|.:
  Fly   336 LTGMLSLTNELLLYVAGKWQSTLKVLDLMF--CVQLNANCIDA---------LRQLSGRLEALTM 389

  Fly   200 KDCSVRVG-----DTPKSIFYSI-ELHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSLKGCQ 258
            ..|....|     .....|.||: ||||  .|.:.::::|..:.     |.:||:||||||..|:
  Fly   390 AYCRELTGTGLLQGLAGDINYSLQELHL--EETIFLDESSMCQL-----LERLPNLRRLSLDNCR 447

  Fly   259 ALCKFVPYGSMAARFGFQ-KLESLDLRQ-TPINNSDLQCF-------SAIENLKELLLES-PQIL 313
               :.|...:||....:| :|.:|::.. ..|.:..|..:       |.:..||||.|.. ..:.
  Fly   448 ---QAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVT 509

  Fly   314 HSKQAVAKK------------NTNGNATDEAASPQPDSLKVLS-------DDEPSTSRAAMEHLR 359
            .|...|..|            |...:...||.:....||:.|.       |||  |....:.:|:
  Fly   510 DSSLMVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDE--TVLNIVSNLK 572

  Fly   360 ACKVAFNLDNCS 371
            ..:| .||.||:
  Fly   573 RLRV-LNLSNCT 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 14/64 (22%)
leucine-rich repeat 610..635 CDD:275381
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 7/24 (29%)
LRR_RI <297..482 CDD:238064 46/205 (22%)
leucine-rich repeat 304..330 CDD:275381 5/25 (20%)
leucine-rich repeat 331..357 CDD:275381 3/25 (12%)
leucine-rich repeat 358..379 CDD:275381 5/31 (16%)
leucine-rich repeat 384..409 CDD:275381 4/24 (17%)
leucine-rich repeat 412..437 CDD:275381 8/31 (26%)
AMN1 430..595 CDD:187754 43/165 (26%)
leucine-rich repeat 438..464 CDD:275381 11/28 (39%)
leucine-rich repeat 465..496 CDD:275381 5/30 (17%)
leucine-rich repeat 497..521 CDD:275381 8/23 (35%)
leucine-rich repeat 522..547 CDD:275381 3/24 (13%)
leucine-rich repeat 548..573 CDD:275381 7/26 (27%)
leucine-rich repeat 574..599 CDD:275381 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457994
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.