DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and CG7148

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_649366.1 Gene:CG7148 / 40432 FlyBaseID:FBgn0046301 Length:454 Species:Drosophila melanogaster


Alignment Length:244 Identity:60/244 - (24%)
Similarity:90/244 - (36%) Gaps:65/244 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EKEHK------ESLDRETECNLMDFCDELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHI 112
            |.:||      :.||.  .|..:.  |..:.:|..| |..|.|.:.:|...|:||         .
  Fly   166 EDQHKAFELQQKYLDE--VCRTLH--DLRVLDIRTY-DMISKLQLGNCLQSFKNL---------T 216

  Fly   113 DLSNGPLPMGILEEILGRATE-------------KTHTIKICGPPSSQHVAGEFRQFTQTLSSVF 164
            ||.   |.:..|:.||....|             :.|...:..|.|..|...|..:|.:      
  Fly   217 DLK---LNLATLKPILPAVLELPSLRKLVVLLDNEWHIPPLVSPDSYDHKIREVSEFYE------ 272

  Fly   165 PRVVQLKVLELEGVSLDFEYIHI-----TEFPA-TLRRLK-LKDCS-VRVGDTPKSIFYSIELHL 221
              ::..|..::.|.::|..|:.:     .:.|. |.|||| |..|| ....|..|......||.|
  Fly   273 --IMAFKAKDIVGFAVDGYYMPLEPGWDEKLPIWTHRRLKRLAICSWTHSADYLKRYTCMTELQL 335

  Fly   222 L---DLEDLSIEDNSWFEPYYIMGLSKL-PSLRRLSLKGCQALC-KFVP 265
            |   :..|||.|        .::...:| |.|..|.:..|:.|. .|:|
  Fly   336 LCVRNWNDLSDE--------ILLEFVELCPRLEHLDVSYCRNLTPTFLP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 10/45 (22%)
leucine-rich repeat 610..635 CDD:275381
CG7148NP_649366.1 leucine-rich repeat 333..358 CDD:275381 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.