DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and fbxl3a

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001005773.3 Gene:fbxl3a / 378451 ZFINID:ZDB-GENE-030912-5 Length:431 Species:Danio rerio


Alignment Length:305 Identity:61/305 - (20%)
Similarity:109/305 - (35%) Gaps:95/305 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 KREKEHKESLDRETECNLMDFCDELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSN 116
            ||.|:..|... :.:.|.:....|:|..|||||.                 |||..|        
Zfish    24 KRPKQPSEDFG-DLQSNWVRLPQEILLHIFQYLP-----------------LLDRAF-------- 62

  Fly   117 GPLPMGILEEILGRATEKTHTIKICGPPSSQHVAGEFRQF--------TQTLSSVFP----RVVQ 169
                          |::..|...     .:.|:...:|.|        |..|.:..|    ::::
Zfish    63 --------------ASQVCHNWN-----HAFHMPELWRCFEFELNQPATSYLKATHPDLIKQIIK 108

  Fly   170 LKVLELEGVSLDFEYIHITEFPATLRRL--KLKDCSVR-VG----------DTPKSIFYSI---- 217
            .....|:.||  |:....||...|...:  :|.:||:: :|          :.|||.|.|.    
Zfish   109 RHSNHLQYVS--FKVDSSTESAETACDILSQLVNCSLKTLGLISTARPSFMELPKSHFISALTVV 171

  Fly   218 -----ELHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSLKGCQALCKFVPYGSMAARFGFQK 277
                 .|..|.::|..::|.|    ..::..:...:|:.|.:..|..:.   |.|.:........
Zfish   172 FVNSKSLSSLKIDDTPVDDPS----LKVLVANNSDTLKLLKMSSCPHVS---PAGILCVADQCHG 229

  Fly   278 LESLDLRQTPINNSDLQCFSA-----IENLK-ELLLESP-QILHS 315
            |..|.|....:::..|...|:     :|:|: :::.|:| |..|:
Zfish   230 LRELALNYHLLSDELLLALSSEKHVHLEHLRIDVVSENPGQQFHT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 12/45 (27%)
leucine-rich repeat 610..635 CDD:275381
fbxl3aNP_001005773.3 F-box-like 40..81 CDD:315592 14/84 (17%)
leucine-rich repeat 178..203 CDD:275381 5/28 (18%)
leucine-rich repeat 204..229 CDD:275381 5/27 (19%)
leucine-rich repeat 230..255 CDD:275381 5/24 (21%)
leucine-rich repeat 256..291 CDD:275381 6/19 (32%)
leucine-rich repeat 292..336 CDD:275381
leucine-rich repeat 337..363 CDD:275381
leucine-rich repeat 364..389 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.