DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Fbxl22

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001102239.1 Gene:Fbxl22 / 363083 RGDID:1311830 Length:236 Species:Rattus norvegicus


Alignment Length:154 Identity:32/154 - (20%)
Similarity:52/154 - (33%) Gaps:46/154 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   598 WIRN-INRSPDNKLERLSLRNYHLITNHTLEHLVQCSPNLVYIDVSGTS-ITLPAIRRFKISKPK 660
            |::: ..||       :..::.:|:.:..|:...:| |||..:.:||.. :|...:.|..:..|:
  Rat    85 WLKSAFQRS-------ICSQHENLVNDFLLQVCNRC-PNLASVTLSGCGHVTDDCLARLLLGCPR 141

  Fly   661 --------CEVVANH-----------LEEFE-------------RL----PELETQEEDDTVVVM 689
                    |..|.|.           |:.|.             ||    |.|....|....::.
  Rat   142 LRALRLENCARVTNRTLAAVAAHGRALQTFHVDFCRNVSAAGLLRLRAACPNLILSAEHSAAMIP 206

  Fly   690 LQPPPRADDEQPPKSPPPQEVVAP 713
            .|||..........||.|....||
  Rat   207 DQPPRARASPASVFSPAPGRQSAP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040
leucine-rich repeat 610..635 CDD:275381 3/24 (13%)
Fbxl22NP_001102239.1 F-box-like 3..43 CDD:403981
AMN1 44..>191 CDD:187754 21/113 (19%)
leucine-rich repeat 116..141 CDD:275381 5/24 (21%)
leucine-rich repeat 142..167 CDD:275381 3/24 (13%)
leucine-rich repeat 168..193 CDD:275381 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.