DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and CG9003

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster


Alignment Length:434 Identity:91/434 - (20%)
Similarity:150/434 - (34%) Gaps:108/434 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LAAVPVQPVLPQ-------IPTEEEPEIKQRKREKEHKESLDRETECNLMDFC------DEL--- 76
            |.||.:.|.:.:       :.:...|::....:::....|...::|.....|.      |||   
  Fly   178 LPAVSINPKIMESSSDSCSLSSSTTPDVGLADQQRNMAGSAQDQSEDQSQTFLGATELDDELIKQ 242

  Fly    77 -----LFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSN------GPLPMGILEEILGR 130
                 |..:|.|||..|:.........:..|.||...:..|:|.:      ||    ::|.|..|
  Fly   243 LPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEGP----VIENISQR 303

  Fly   131 ATEKTHTIKICGPPSSQHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSLDFEYIHITEFPATLR 195
            ......::.:.|..|    .|:  |..:||::....:..|.:.:.:.:: |.....|:.:.:.|.
  Fly   304 CRGFLKSLSLRGCQS----VGD--QSVRTLANHCHNIEHLDLSDCKKIT-DISTQSISRYCSKLT 361

  Fly   196 RLKLKDCSVRVGDTPKSIFYSIELHLLD----LEDLSIEDNSWFEPYYIMGLSKLP----SLRRL 252
            .:.|..||   ..|..|:.|     |.|    |.::::   ||.......|:..|.    .||:.
  Fly   362 AINLHSCS---NITDNSLKY-----LSDGCPNLMEINV---SWCHLISENGVEALARGCVKLRKF 415

  Fly   253 SLKGCQ--------ALCKFVPYGSMAARFGFQKLESLDLRQTPINNSDLQ--CFSAIENLKEL-L 306
            |.|||:        .|.|:.|...:......:.:....:||...|...||  |.|...:|.:| |
  Fly   416 SSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTL 480

  Fly   307 LESPQILHSKQAVAKKNTNGNATD------------------EAASPQPD-SLKVLSDDEPSTSR 352
            |...|..|....:...... |.||                  |..|...| :|..|:...||..:
  Fly   481 LSLSQHNHLLNTLEVSGCR-NFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEK 544

  Fly   353 AAMEHLR-------------ACKV----AFNLDNC---SDRKEE 376
            ..:.|..             :|..    ...||||   :||..|
  Fly   545 LTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLE 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 14/59 (24%)
leucine-rich repeat 610..635 CDD:275381
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 10/44 (23%)
leucine-rich repeat 280..307 CDD:275381 7/30 (23%)
AMN1 <308..453 CDD:187754 32/162 (20%)
leucine-rich repeat 308..327 CDD:275381 4/24 (17%)
leucine-rich repeat 334..359 CDD:275381 3/25 (12%)
leucine-rich repeat 360..385 CDD:275381 9/32 (28%)
leucine-rich repeat 386..411 CDD:275381 5/27 (19%)
AMN1 <409..586 CDD:187754 39/177 (22%)
leucine-rich repeat 412..437 CDD:275381 8/24 (33%)
leucine-rich repeat 438..463 CDD:275381 3/24 (13%)
leucine-rich repeat 464..515 CDD:275381 13/51 (25%)
leucine-rich repeat 516..541 CDD:275381 5/24 (21%)
leucine-rich repeat 542..561 CDD:275381 1/18 (6%)
leucine-rich repeat 571..595 CDD:275381 7/18 (39%)
leucine-rich repeat 596..621 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.