DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and CG9316

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_610051.2 Gene:CG9316 / 35333 FlyBaseID:FBgn0032878 Length:448 Species:Drosophila melanogaster


Alignment Length:442 Identity:84/442 - (19%)
Similarity:135/442 - (30%) Gaps:173/442 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NLMDFCDELLFEIFQYLDTSSILAVMHC-SPRFENLL-----LDHRFYHHIDLSNGPLPMGILEE 126
            :|:|..::::..:.::|...:...::.| :|:|....     :.......:.|...|||..|   
  Fly    41 SLLDLPEDIIRLVLEFLPRITDKVLLACVAPKFRAAFEGWARVQRNALDMVSLETVPLPQLI--- 102

  Fly   127 ILGRATEKTHTIKICGP--------------------------PSSQHVA-----GEFRQFTQTL 160
                     ...|:.||                          |:.:.::     .||.     .
  Fly   103 ---------RFFKVAGPFIRVLQVDCASYQKESLLVEFVKEYCPNLEEISYSNATDEFH-----Y 153

  Fly   161 SSVFPRVVQLKVLELEGVSLD---------------FEYI-------HITEFPATLRRLKLKDC- 202
            .|:..::..||.:.:|.:..:               ||.:       ::..|| .|:.|.|:|| 
  Fly   154 RSIMSKMTHLKRVTIECLDAEDVLNFDMQPNQELEFFELVNGCYTGQNLCGFP-NLKTLVLRDCL 217

  Fly   203 ---SVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLS-------------------- 244
               |:..|...||      ||.|||:|...|         :|.:|                    
  Fly   218 LWNSMEFGIPLKS------LHTLDLDDCCFE---------VMNVSLYQKIAESCTNLVELIFSGC 267

  Fly   245 --------KLPSLRRLSLKGCQALCKFVPYGSMAARFGF---------QKLESLDLR-QTPINNS 291
                    .||.|.|.:||....        |.....||         .||..|.|. |..|.|.
  Fly   268 DTNFEVIANLPKLERCTLKTWMT--------SNELNIGFLTVLAEKRGNKLTHLHLSGQFNITNE 324

  Fly   292 DLQCFSAIENLKELLLESPQIL---HSK-------------QAVAKKNTNGNATDEAASPQPDSL 340
            ..:|...:.:|.:|...:..||   |.|             .|..:....|........||   |
  Fly   325 HARCLGQLSSLTDLRFSNNDILDDDHFKFFNDLSQLERFGLTACGRVMDVGMMRMLRKCPQ---L 386

  Fly   341 KV--LSDDEPSTSRAAMEHLRACK------VAFNLDNCSDRKEEKSPVPTEP 384
            ||  |:|.|..|....::.:..|.      |..|:.....|:    |:.|.|
  Fly   387 KVIDLTDCEQITEEFVIQAIGFCSKGSGRDVVLNVKGTMIRR----PILTHP 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 6/51 (12%)
leucine-rich repeat 610..635 CDD:275381
CG9316NP_610051.2 leucine-rich repeat 208..221 CDD:275381 5/12 (42%)
leucine-rich repeat 231..258 CDD:275381 9/35 (26%)
leucine-rich repeat 259..279 CDD:275381 1/19 (5%)
leucine-rich repeat 280..309 CDD:275381 7/36 (19%)
AMN1 310..>411 CDD:187754 25/103 (24%)
leucine-rich repeat 310..334 CDD:275381 7/23 (30%)
leucine-rich repeat 335..359 CDD:275381 6/23 (26%)
leucine-rich repeat 360..385 CDD:275381 2/24 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457951
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.