DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and CG13088

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_609234.2 Gene:CG13088 / 34180 FlyBaseID:FBgn0032047 Length:401 Species:Drosophila melanogaster


Alignment Length:383 Identity:78/383 - (20%)
Similarity:127/383 - (33%) Gaps:147/383 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 HKESLDRETECNLMDFCDE--LLFEIF-------------------------------QYLDTSS 88
            |..|||...:.||.:..:|  ||.|:|                               :|||.. 
  Fly    96 HLRSLDCHMDYNLEEADEETLLLTELFPLLTRLSLNSSTTGRYLWHWKQLRELNLTWCEYLDPD- 159

  Fly    89 ILAVMHCSPRFENLLLDH--RFYHHIDLSNGPLPMGILEEILGRAT--EKTHTIKICGPPSSQHV 149
                 |....|.||.|..  ..|:..:::.|...:.|.     |.|  |:.|.       ...|:
  Fly   160 -----HFEEIFGNLQLTKLTMLYYGYNVNLGEKVVDIT-----RCTTLEELHI-------DDHHL 207

  Fly   150 AGEFRQFTQTLSSVFPRVVQL-KVLELEGVSLD-FEYIHITEFPATLRRLKLKDCSVRVGDTPKS 212
            .|:|          .||::.| ....|...:.| :||:    ..:..|...||..|:...|:   
  Fly   208 LGDF----------LPRLMNLPHFRRLAFYTRDYYEYL----LGSVARHKPLKVQSLLFNDS--- 255

  Fly   213 IFYSIE------LHLLDLEDLSIEDNSW--------------FEPYYIMGLSKLPSLRRL--SLK 255
             |:|.|      ||:.:|..|.::::..              .|..:::.:.::||...|  |:.
  Fly   256 -FWSSERVAGSILHMTNLRRLVLQEDDIDAQQLHTICHKLPNLEELHLLAMREVPSPSHLWNSIG 319

  Fly   256 GCQALCKFVPYGSMAARFGFQKLESLDLRQTPINNSDLQCFSAIENLKELLLES--PQILHSKQA 318
            .|..                  |..|:|..|.:.:....|      |.::||..  |..||    
  Fly   320 HCHL------------------LRILNLSSTKLVDLRSSC------LTKVLLSRRIPLTLH---- 356

  Fly   319 VAKKNTNGNATDEAASPQPDSLKVLSDDEPSTSRAAME--HL-----RACKVAFNLDN 369
              ..||.           .|..|||.|.:.::.:.:.|  ||     |..::.|:.|:
  Fly   357 --LHNTG-----------LDPSKVLRDFDSASLKISFEPIHLNIWSPRFVEIEFSPDS 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 16/80 (20%)
leucine-rich repeat 610..635 CDD:275381
CG13088NP_609234.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.