DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and jet

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_608880.2 Gene:jet / 33705 FlyBaseID:FBgn0031652 Length:319 Species:Drosophila melanogaster


Alignment Length:264 Identity:56/264 - (21%)
Similarity:93/264 - (35%) Gaps:70/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NLMDFC--DELLFEIFQYLDTSSILAVMHCS---PRFENLLLDHRFYHHIDLSNGPLPMGILEEI 127
            :|.|.|  |.|:.::..||....:..:..||   .||....|:.|...|:. .|....:.:...:
  Fly    40 SLFDVCWDDVLIPQVAVYLSLKDLFNLRCCSRTAQRFVEAALEKRQELHLS-GNNTKNIDVAFRV 103

  Fly   128 LGRATEKTHTIKICGPPSSQHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSLDFEYIHITEFP- 191
            |.|..::...:         |:|. .|..|..|  :.|.:...| ..|..|:|: |.::||... 
  Fly   104 LARCCQRLEVL---------HLAC-CRWLTDEL--LLPLLANNK-KRLWAVNLN-ECVNITALSL 154

  Fly   192 -------ATLRRLKLKDCS-VRVGDTPKSIFYSIELHLLDLEDLSIEDNSW-------------- 234
                   ..||.|||..|. :..|...     ::.||...|.:..|   |:              
  Fly   155 QPIIVECKELRVLKLSKCQWLTTGAVD-----ALTLHQSKLVEFDI---SYCGAIGERCLIIFFR 211

  Fly   235 -FEPYYIMGLSKLPS---------------LRRLSLKGCQALCKFVPYGSMAARFGFQKLESLDL 283
             .....::.|:..||               |..:::.||.|:.   .||..|......:|.:|.:
  Fly   212 KLNKLTVLSLANTPSVTDQVLIQIGNYCRELEHINVIGCAAIS---DYGVHALTVHCLRLRTLLI 273

  Fly   284 RQTP 287
            |:.|
  Fly   274 RRCP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 14/50 (28%)
leucine-rich repeat 610..635 CDD:275381
jetNP_608880.2 leucine-rich repeat 85..110 CDD:275381 4/25 (16%)
AMN1 96..>261 CDD:187754 36/189 (19%)
leucine-rich repeat 111..137 CDD:275381 7/38 (18%)
leucine-rich repeat 138..163 CDD:275381 6/25 (24%)
leucine-rich repeat 164..189 CDD:275381 9/29 (31%)
leucine-rich repeat 190..215 CDD:275381 3/27 (11%)
leucine-rich repeat 216..241 CDD:275381 3/24 (13%)
leucine-rich repeat 242..267 CDD:275381 7/27 (26%)
leucine-rich repeat 268..290 CDD:275381 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457950
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.