DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and CG15412

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001259996.1 Gene:CG15412 / 33553 FlyBaseID:FBgn0031528 Length:486 Species:Drosophila melanogaster


Alignment Length:285 Identity:61/285 - (21%)
Similarity:95/285 - (33%) Gaps:88/285 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DELLFEI------FQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGRAT 132
            |.||.||      .|.||.|....:....               |||    |..|:..:.|    
  Fly   156 DRLLEEIGNCCTRLQILDISGETDITEIG---------------IDL----LAKGVCSQSL---- 197

  Fly   133 EKTHTIKICGPPSSQHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSLDF-------------EY 184
                |:...|.|..:::.  :......|... |:|..|......|.||.|             :|
  Fly   198 ----TVVDVGMPGEENIC--YSDIALILEHC-PQVETLSTYSFVGASLKFIHDNVDDRFKCRLKY 255

  Fly   185 IHITEFPATLRRLKLKDC---SVRVGDTPKS---------------IFYSIELHLLDLEDLSIED 231
            ||.|.......::.::.|   .....|:||:               |:..:...||.|.:..|..
  Fly   256 IHDTGTDEATLQVIMQTCPRLETLYLDSPKTGSLRALSTRNLRKLKIYKFVVAELLPLLERPIGR 320

  Fly   232 NSWFEPYYIMGLSKLPSLRRLSLKGCQALC-----------KFVPYGSMAARFGFQKLESLDLRQ 285
            |       :..|:.:..|..|.|.....||           ..:.||:..|:  ||:||.|::..
  Fly   321 N-------LRHLTMIKGLGNLELGKLARLCPSLIDLDCYMIDSLSYGAGHAK--FQQLEGLEILS 376

  Fly   286 TPINNSDLQCFSA-IENLKELLLES 309
            :.|..|.|:.|.. ..:||.|.:::
  Fly   377 SAILTSSLKAFLCNSTDLKRLAVDT 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 10/45 (22%)
leucine-rich repeat 610..635 CDD:275381
CG15412NP_001259996.1 AMN1 <142..>228 CDD:187754 21/101 (21%)
leucine-rich repeat 145..168 CDD:275381 5/11 (45%)
leucine-rich repeat 169..196 CDD:275381 9/45 (20%)
leucine-rich repeat 197..224 CDD:275381 5/37 (14%)
leucine-rich repeat 225..252 CDD:275381 6/26 (23%)
leucine-rich repeat 253..275 CDD:275381 5/21 (24%)
leucine-rich repeat 369..393 CDD:275381 7/23 (30%)
leucine-rich repeat 394..416 CDD:275381 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.