DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and fbxl14b

DIOPT Version :10

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001015043.1 Gene:fbxl14b / 324835 ZFINID:ZDB-GENE-030131-3556 Length:400 Species:Danio rerio


Alignment Length:214 Identity:53/214 - (24%)
Similarity:79/214 - (36%) Gaps:60/214 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGRATEKTHTI 138
            |..|..|.|||....:|.:..||                :::|    .|:|....|....|:..:
Zfish   132 DSSLGRIAQYLKNLEVLELGGCS----------------NITN----TGLLLIAWGLHRLKSLNL 176

  Fly   139 KICGPPSS---QHVAGEFRQFTQ-------------------TLSSVFPRVVQLKVLELE---GV 178
            :.|...|.   .|:||..|...:                   :|..:...:.:||||.|.   |:
Zfish   177 RSCRHVSDVGIGHLAGMTRSAAEGCLSLEYLTLQDCQKLTDLSLKHISKGLTKLKVLNLSFCGGI 241

  Fly   179 SLDFEYIHITEFPATLRRLKLKDCSVRVGDTPKSIFY----SIELHLLDLEDL-SIEDNSWFEPY 238
            | |...||::.. .:|..|.|:.|. .:.||  .|.:    ::.|..||:... .|.|.|.  .|
Zfish   242 S-DAGMIHLSHM-TSLWSLNLRSCD-NISDT--GIMHLAMGTLRLSGLDVSFCDKIGDQSL--AY 299

  Fly   239 YIMGLSKLPSLRRLSLKGC 257
            ...||.:|.|   |||..|
Zfish   300 IAQGLYQLKS---LSLCSC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 69..111 CDD:425796 9/36 (25%)
leucine-rich repeat 610..635 CDD:275381
fbxl14bNP_001015043.1 F-box_FBXL14 6..46 CDD:438897
AMN1 90..296 CDD:187754 43/188 (23%)
leucine-rich repeat 92..118 CDD:275381
leucine-rich repeat 119..144 CDD:275381 6/11 (55%)
leucine-rich repeat 145..170 CDD:275381 7/44 (16%)
leucine-rich repeat 171..203 CDD:275381 7/31 (23%)
leucine-rich repeat 204..229 CDD:275381 1/24 (4%)
AMN1 230..388 CDD:187754 32/96 (33%)
leucine-rich repeat 230..254 CDD:275381 10/25 (40%)
leucine-rich repeat 255..280 CDD:275381 7/27 (26%)
leucine-rich repeat 281..304 CDD:275381 7/24 (29%)
leucine-rich repeat 307..331 CDD:275381 6/12 (50%)
leucine-rich repeat 332..357 CDD:275381
leucine-rich repeat 358..382 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.