DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Fbxl17

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_038939705.1 Gene:Fbxl17 / 316663 RGDID:1309773 Length:739 Species:Rattus norvegicus


Alignment Length:411 Identity:83/411 - (20%)
Similarity:147/411 - (35%) Gaps:110/411 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EQAELGSTCLAAPKRRFPDNE-RCGRELAAVPVQPVLPQIPTEEEPEIKQRKREKEHKESLDRET 65
            :|.|.|.:....|    |:|. .|.||             |..|.|:|.|               
  Rat   286 QQPESGDSDCQEP----PENPCDCHRE-------------PPPEIPDINQ--------------- 318

  Fly    66 ECNLMDFCDELLFEIFQ--YLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEIL 128
                  ....:|.:||.  .||...:.|.:.|. .:.:|.||.:|:..:|||:   ...:.:|:|
  Rat   319 ------LPPSILLKIFSNLSLDERCLSASLVCK-YWRDLCLDFQFWKQLDLSS---RQQVTDELL 373

  Fly   129 GRATEKTHTI--------------KIC-----GPPSSQHVAGEFRQFTQT----LSSVFPRVVQL 170
            .:...::..|              .:|     .|...::.|...:|.:.|    ::|..|.:.::
  Rat   374 EKIASRSQNIVEINISDCRSMSDSGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKV 438

  Fly   171 KV-----LELEGVSLDFEYIHITEFPATLRRLK---LKDCSVRVGDTPKSIFYSIELHLLDLEDL 227
            .|     |..||         :.:..:..|.||   ...| .::.|....:   |....|.|:.:
  Rat   439 HVGNQDKLTDEG---------LKQLGSKCRELKDIHFGQC-YKISDEGMVV---IAKSCLKLQRI 490

  Fly   228 SIEDNSWFEPYYIMGLSK-LPSLRRLSLKGCQALCKFVPYGSMAARFGFQKLESLDLRQ-TPINN 290
            .:::|.......:...:: .|.|:.:...||....|.|.:.:.     .:.|.|||||. |.::|
  Rat   491 YMQENKLVTDQSVKAFAEHCPDLQCVGFMGCSVTSKGVIHLTK-----LRNLSSLDLRHITELDN 550

  Fly   291 SD-LQCFSAIENLKELLLESPQILHSK--QAVAKKNTNGNATDEAASPQPDSLKVLSDDEPSTSR 352
            .. ::.....:||..|.|....|::.:  :.:||:   |.:..|....   |.|:....:...|.
  Rat   551 ETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKE---GQSLKELYLV---SCKITDYGQRGNSG 609

  Fly   353 AA-----MEHLRACKVAFNLD 368
            ||     ..||:.|......|
  Rat   610 AAGTAVPSHHLQHCPAGLQED 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 11/47 (23%)
leucine-rich repeat 610..635 CDD:275381
Fbxl17XP_038939705.1 F-box-like 316..361 CDD:403981 13/66 (20%)
leucine-rich repeat 357..382 CDD:275381 5/27 (19%)
leucine-rich repeat 383..408 CDD:275381 2/24 (8%)
AMN1 406..568 CDD:187754 36/179 (20%)
leucine-rich repeat 409..434 CDD:275381 4/24 (17%)
leucine-rich repeat 435..460 CDD:275381 4/33 (12%)
leucine-rich repeat 461..486 CDD:275381 5/28 (18%)
leucine-rich repeat 487..512 CDD:275381 2/24 (8%)
leucine-rich repeat 513..536 CDD:275381 5/27 (19%)
leucine-rich repeat 537..562 CDD:275381 8/24 (33%)
leucine-rich repeat 563..588 CDD:275381 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.