DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Fbxl12

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_006242701.1 Gene:Fbxl12 / 313782 RGDID:1305528 Length:326 Species:Rattus norvegicus


Alignment Length:221 Identity:53/221 - (23%)
Similarity:94/221 - (42%) Gaps:22/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LMDFCDELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGR-AT 132
            |.|..|.:|.|||.||.....:.:.....|::.|:.|...:.|:||:...:...::..:|.| ..
  Rat     4 LFDLPDLVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMA 68

  Fly   133 EKTHTIKICGPPSSQHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSL---DFEYIHITEFPATL 194
            .:.|::::.|...|...|.:       ||....|.:..|...|:.:.|   |...:.||..|:||
  Rat    69 SRLHSLRMGGYLFSGSQAPQ-------LSPALMRALGQKCPNLKRLCLHVADLSMVPITSLPSTL 126

  Fly   195 RRLKLKDCSVRV----GDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSLK 255
            |.|:|..|.:.:    .:...::...:|..:||....       |...::.||::..:||.|.|.
  Rat   127 RTLELHSCEISMIWLQKEQDPTVLPLLECIVLDRVPA-------FRDEHLQGLTRFRALRSLVLG 184

  Fly   256 GCQALCKFVPYGSMAARFGFQKLESL 281
            |...:.:.....|:......|:||.|
  Rat   185 GTYRVTETGLDSSLQELSYLQRLEVL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 13/44 (30%)
leucine-rich repeat 610..635 CDD:275381
Fbxl12XP_006242701.1 F-box-like 4..48 CDD:403981 13/43 (30%)
leucine-rich repeat 104..125 CDD:275381 6/20 (30%)
AMN1 121..>226 CDD:187754 23/97 (24%)
leucine-rich repeat 126..152 CDD:275381 5/25 (20%)
leucine-rich repeat 153..177 CDD:275381 6/30 (20%)
leucine-rich repeat 178..203 CDD:275381 6/24 (25%)
leucine-rich repeat 204..229 CDD:275381 4/7 (57%)
leucine-rich repeat 230..253 CDD:275381
leucine-rich repeat 254..283 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 1 1.000 - - FOG0009915
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5688
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.