DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Fbxl15

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001101073.1 Gene:Fbxl15 / 309453 RGDID:1306444 Length:300 Species:Rattus norvegicus


Alignment Length:236 Identity:55/236 - (23%)
Similarity:89/236 - (37%) Gaps:45/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 QHVAGEFRQFTQ------------TLSSVFPRVVQLKVL-ELEGVS-----------LDFEYIHI 187
            |.|:..||...|            .:....||...:::| :.||:.           ||.:.:.:
  Rat    45 QRVSRAFRALVQLHLARLRRFDAAQVGPQIPRAALVRLLRDAEGLQELALAPCHEWLLDEDLVPV 109

  Fly   188 TEFPATLRRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLS-KLPSLRR 251
            ......||.:.|..|    |...:....::......|:.:|:....|.:...:.||: :.|:|..
  Rat   110 LARNPQLRSVALAGC----GQLSRRALGALAEGCPRLQRISLAHCDWVDGLALRGLADRCPALEE 170

  Fly   252 LSLKGCQAL-CKFVPYGSMAARFGFQKLESLDLRQTPINNSDLQCFSAIENLKELLLESPQILH- 314
            |.|..|:.| .:.:.|  :|.|.| ..|.||.| ....|..|    :|::   ||....||:.| 
  Rat   171 LDLTACRQLKDEAIVY--LAQRRG-AGLRSLSL-AVNANVGD----TAVQ---ELARNCPQLEHL 224

  Fly   315 SKQAVAKKNTNGNATDEAASPQPDSLKVLSDD---EPSTSR 352
            ......:..::|..|.....|...||:|....   |||.||
  Rat   225 DLTGCLRVGSDGVRTLAEYCPALRSLRVRHCHHVAEPSLSR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040
leucine-rich repeat 610..635 CDD:275381
Fbxl15NP_001101073.1 F-box 18..55 CDD:395521 4/9 (44%)
leucine-rich repeat 62..88 CDD:275381 3/25 (12%)
leucine-rich repeat 89..115 CDD:275381 2/25 (8%)
Interaction with SMURF1. /evidence=ECO:0000250 113..269 43/168 (26%)
leucine-rich repeat 116..141 CDD:275381 5/28 (18%)
AMN1 <139..>268 CDD:187754 38/138 (28%)
leucine-rich repeat 142..167 CDD:275381 5/24 (21%)
leucine-rich repeat 168..194 CDD:275381 9/28 (32%)
leucine-rich repeat 195..220 CDD:275381 9/32 (28%)
leucine-rich repeat 221..245 CDD:275381 3/23 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.