DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Fbxl12

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001273458.1 Gene:Fbxl12 / 30843 MGIID:1354738 Length:349 Species:Mus musculus


Alignment Length:192 Identity:43/192 - (22%)
Similarity:82/192 - (42%) Gaps:22/192 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RFENLLLDHRFYHHIDLSNGPLPMGILEEILGR-ATEKTHTIKICGPPSSQHVAGEFRQFTQTLS 161
            |::.|:.|...:.|:||:...:...::..:|.| ...:.:::::.|...|...|.:       ||
Mouse    56 RWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASRLYSLRMGGYLFSGSQAPQ-------LS 113

  Fly   162 SVFPRVVQLKVLELEGVSL---DFEYIHITEFPATLRRLKLKDCSVRV----GDTPKSIFYSIEL 219
            ....|.:..|...|:.:.|   |...:.||..|:|||.|:|..|.:.:    .:...::...:|.
Mouse   114 PALMRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMIWLQKEQDPTVLPLLEC 178

  Fly   220 HLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSLKGCQALCKFVPYGSMAARFGFQKLESL 281
            .:||....       |...::.||::..:||.|.|.|...:.:.....|:......|:||.|
Mouse   179 IVLDRVPA-------FRDEHLQGLTRFRALRSLVLGGTYRVTETGLDASLQELSYLQRLEVL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 4/15 (27%)
leucine-rich repeat 610..635 CDD:275381
Fbxl12NP_001273458.1 F-box-like <51..73 CDD:289689 5/16 (31%)
leucine-rich repeat 127..148 CDD:275381 6/20 (30%)
AMN1 144..>249 CDD:187754 23/97 (24%)
leucine-rich repeat 149..175 CDD:275381 5/25 (20%)
leucine-rich repeat 176..200 CDD:275381 6/30 (20%)
leucine-rich repeat 201..226 CDD:275381 6/24 (25%)
leucine-rich repeat 227..252 CDD:275381 4/7 (57%)
leucine-rich repeat 253..276 CDD:275381
leucine-rich repeat 277..306 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 1 1.000 - - FOG0009915
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5688
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.