| Sequence 1: | NP_651593.1 | Gene: | CG5003 / 43344 | FlyBaseID: | FBgn0039554 | Length: | 713 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_038937.2 | Gene: | Fbxl6 / 30840 | MGIID: | 1354705 | Length: | 535 | Species: | Mus musculus |
| Alignment Length: | 385 | Identity: | 85/385 - (22%) |
|---|---|---|---|
| Similarity: | 119/385 - (30%) | Gaps: | 161/385 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 15 KRRFPDNERCGRELAAVPVQPVLPQIPTEEEPEIKQRKREKEHKESLDRETECNLMDFCD-ELLF 78
Fly 79 EIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGRAT-------EKT- 135
Fly 136 -----HTI----KICGPPSSQHVAGEFRQFTQTLSSVFP-RVVQLKVLELEGVSLDFEYIH---- 186
Fly 187 -------ITEFPATLRRLKLKDCSVRVGDTPKSIFYS-IELHLLDLEDLSIEDNS---------- 233
Fly 234 -----WF----EPYYIMGL---SKLPSLRRLSL-------------------KGCQAL------- 260
Fly 261 -------C-KFVPYGSMAARFGFQKLESLDLRQTPINNSDLQCFSAIENLKELLLESPQI 312 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5003 | NP_651593.1 | F-box | 68..114 | CDD:279040 | 7/46 (15%) |
| leucine-rich repeat | 610..635 | CDD:275381 | |||
| Fbxl6 | NP_038937.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..25 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 61..99 | 13/49 (27%) | |||
| F-box-like | 105..155 | CDD:289689 | 18/83 (22%) | ||
| LRR 1 | 169..195 | 9/35 (26%) | |||
| AMN1 | 171..390 | CDD:187754 | 51/228 (22%) | ||
| leucine-rich repeat | 188..213 | CDD:275381 | 6/33 (18%) | ||
| LRR 2 | 196..221 | 5/24 (21%) | |||
| leucine-rich repeat | 214..239 | CDD:275381 | 7/24 (29%) | ||
| LRR 3 | 222..247 | 7/24 (29%) | |||
| leucine-rich repeat | 240..291 | CDD:275381 | 9/50 (18%) | ||
| LRR 4 | 273..299 | 5/25 (20%) | |||
| leucine-rich repeat | 292..321 | CDD:275381 | 5/28 (18%) | ||
| LRR 5 | 304..329 | 4/24 (17%) | |||
| leucine-rich repeat | 322..349 | CDD:275381 | 7/31 (23%) | ||
| LRR 6 | 330..357 | 10/31 (32%) | |||
| AMN1 | <349..500 | CDD:187754 | 12/36 (33%) | ||
| leucine-rich repeat | 350..377 | CDD:275381 | 11/32 (34%) | ||
| LRR 7 | 360..385 | 8/25 (32%) | |||
| leucine-rich repeat | 378..401 | CDD:275381 | 0/1 (0%) | ||
| LRR 8 | 386..411 | ||||
| LRR 9 | 415..441 | ||||
| leucine-rich repeat | 434..466 | CDD:275381 | |||
| leucine-rich repeat | 467..491 | CDD:275381 | |||
| LRR 10 | 474..499 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167843072 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR16134 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.030 | |||||