DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Fbxl21

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_038951543.1 Gene:Fbxl21 / 306750 RGDID:1305555 Length:460 Species:Rattus norvegicus


Alignment Length:538 Identity:101/538 - (18%)
Similarity:169/538 - (31%) Gaps:183/538 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 TLRRLKLKDCSVRVGDTPKSIFYSI--ELHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSLK 255
            :||:.::....:..|..|..:...|  .|.|:|....|....||.|.::|      |.|.|    
  Rat    55 SLRQTQMLSALLDWGTLPHHVILRIFQYLPLVDRARASSVCRSWNEVFHI------PDLWR---- 109

  Fly   256 GCQALCKFVPYGSMAARFGFQKLESLDLRQTPINNSDLQCFSAIENLKELLLESPQILHSKQAVA 320
                            :|.|:           :|.|....|.:..         |.::   |.:.
  Rat   110 ----------------KFEFE-----------LNQSATSYFKSTH---------PDLI---QQII 135

  Fly   321 KKNTNGNATDEAASPQPDSLKVLSDDEPSTSRAAMEHLRACKVAFNLDNCSDRKEEKSPVPTEPP 385
            ||:        ||..|..|.||.|..|.:.:        ||.:...|.|||  .:....:.|..|
  Rat   136 KKH--------AAHLQYVSFKVDSSTESAEA--------ACHILSQLVNCS--IQTLGLISTAKP 182

  Fly   386 S------------------EGQDLQAKRIRAPSESDDEDTSSTSGSSSDKLEVLSLPRNGHSNAA 432
            |                  ..:.|.:.:|. .:..||........::||.|.:|.          
  Rat   183 SFMNMPKSHFVSALTVVFVNSKSLSSIKIE-DTPVDDPSLKILVANNSDTLRLLK---------- 236

  Fly   433 PLSGGVDLPPLPHAADAANAADAPIAVDAANIEAPGQSPGLDPRPPRAYIYVPDAENANPRQQRS 497
                   :...||.     ::|..:.|       .....||.......||.             |
  Rat   237 -------MSSCPHV-----SSDGILCV-------ADHCQGLRELALNYYIL-------------S 269

  Fly   498 VVAVFAQGTEQRYIYVNQQFSLPMNVLMPTR---RHRTHPRPNYDQVVQHPMFWNMLEPLDRDYA 559
            ...:.|..:|   .:||.: .|.::|:....   :..:..:|::|.:|:|               
  Rat   270 DELLLALSSE---THVNLE-HLRIDVVSENPGQIKFHSIKKPSWDALVKH--------------- 315

  Fly   560 RRVRPRPPSCQTTPQYYVTDRAMYSFGRADRPVQPDVVWIRNINRSPDNKLERLSLRNYHLITNH 624
                  .|.......:::.:....:|.:.:.|| ..:.:.|:::|:   .|.|:.|....||   
  Rat   316 ------SPGVNVVMYFFLYEEEFDTFFKEETPV-THLYFGRSVSRT---ILGRIGLNCPRLI--- 367

  Fly   625 TLEHLVQCSPNLVYIDVSGTSITLPAIRRFKISKPKCEVVANHLEEF-----ERLPELETQEEDD 684
               .||.|:..|..:|.....|.........:...:|||..:...||     .||.:|...||  
  Rat   368 ---ELVVCANGLQPLDSELIRIAEHCKNLTALGLSECEVSCSAFVEFVRLCGRRLTQLSLMEE-- 427

  Fly   685 TVVVMLQPPPRADDEQPP 702
                :|.|    ||...|
  Rat   428 ----VLVP----DDRYTP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040
leucine-rich repeat 610..635 CDD:275381 8/24 (33%)
Fbxl21XP_038951543.1 F-box-like 68..111 CDD:403981 14/68 (21%)
leucine-rich repeat 206..231 CDD:275381 5/25 (20%)
leucine-rich repeat 232..257 CDD:275381 6/53 (11%)
leucine-rich repeat 258..283 CDD:275381 6/40 (15%)
leucine-rich repeat 284..318 CDD:275381 6/55 (11%)
leucine-rich repeat 329..365 CDD:275381 8/39 (21%)
AMN1 <359..>424 CDD:187754 17/70 (24%)
leucine-rich repeat 366..392 CDD:275381 8/31 (26%)
leucine-rich repeat 393..418 CDD:275381 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.