DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Fbxl3

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001094038.1 Gene:Fbxl3 / 306129 RGDID:1305660 Length:428 Species:Rattus norvegicus


Alignment Length:308 Identity:49/308 - (15%)
Similarity:110/308 - (35%) Gaps:85/308 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EEEPEIKQRKREKEHKESLDRETECNLMDFCDELLFEIFQYLDTSSILAVMHCSPRFENLLLDHR 107
            ::.||....::.|:.:.:.:....|:..:...:::..:|:||.                 |||  
  Rat    10 QDSPEEGTAEKPKKPRTTHECSQPCDWGNLLQDIVLHVFKYLP-----------------LLD-- 55

  Fly   108 FYHHIDLSNGPLPMGILEEILGRATEKTHTIKICGPPSSQ-HVAGEFRQF--------TQTLSSV 163
                                      :.|..::|...:.. |:...:|.|        |..|.:.
  Rat    56 --------------------------RAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKAT 94

  Fly   164 FPRVVQLKVLELEGVSLDFEYIHITEFPATLRRL-----KLKDCSVR-VG----------DTPKS 212
            .|.::: ::::.....|.:....:.....:....     :|.:||:: :|          |.|||
  Rat    95 HPELIK-QIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKS 158

  Fly   213 IFYS----IELHLLDLEDLSIEDNSWFEP-YYIMGLSKLPSLRRLSLKGCQALCKFVPYGSMAAR 272
            .|.|    :.::...|..|.|:|....:| ..::..:...:|:.|.:..|..:.   |.|.:...
  Rat   159 HFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVS---PAGILCVA 220

  Fly   273 FGFQKLESLDLRQTPINNSDLQCFSA-----IENLK-ELLLESPQILH 314
            .....|..|.|....:::..|...|:     :|:|: :::.|:|...|
  Rat   221 DQCHGLRELALNYHLLSDELLLALSSEKHVRLEHLRIDVVSENPGQTH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 6/45 (13%)
leucine-rich repeat 610..635 CDD:275381
Fbxl3NP_001094038.1 F-box-like 36..77 CDD:403981 9/85 (11%)
leucine-rich repeat 174..199 CDD:275381 5/24 (21%)
leucine-rich repeat 200..225 CDD:275381 5/27 (19%)
leucine-rich repeat 252..286 CDD:275381 5/17 (29%)
leucine-rich repeat 287..333 CDD:275381
leucine-rich repeat 334..360 CDD:275381
leucine-rich repeat 361..383 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.