DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Fbxo39

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001034107.1 Gene:Fbxo39 / 303287 RGDID:1311464 Length:443 Species:Rattus norvegicus


Alignment Length:337 Identity:66/337 - (19%)
Similarity:111/337 - (32%) Gaps:112/337 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EEEPEIKQRKREKEHKESLDRETECNLMDFCDELLFEIFQYL-DTSSILAVMHCSPRFENLLLDH 106
            :|:.|:.|.:         |:.....|.|.|   |..:|.:| |.....|.:.|. ::..::...
  Rat     2 DEDSEVTQPQ---------DQSCWATLPDVC---LRRVFWWLGDRDRSRAALVCR-KWNQIMYSA 53

  Fly   107 RFYHHIDLSNGPLPMGILEEILGRATEKTHTIKICGPPSSQHVAGEFRQFTQTLSSV--FPRVVQ 169
            ..:.:                        .||...|.||..|.:    :|...|..|  |.|  .
  Rat    54 DLWRY------------------------RTITFSGRPSRVHAS----EFESALWYVKKFGR--Y 88

  Fly   170 LKVLELEGVSLDFEYIHITEFPATLRRL---------KLKDCSVRVGDTPKSIFYSIELHLL--- 222
            |:.||::.:: .:..:...:|..|:|.|         :|:..|::          .:||..|   
  Rat    89 LEHLEIKFLN-PYNAVLTKKFQVTMRGLLSCLGKSNNRLRSLSIQ----------HLELDRLVWR 142

  Fly   223 -DLEDLSIEDNSWFEPYYIMGLSKL-PSLRRLSLKGCQALCKFVPYGSMAARFGFQKLESLDLRQ 285
             .:....|:..|:|       |.|: ..|..|||||.:          :....|...|.||...:
  Rat   143 NSIRGSLIKSLSFF-------LKKMGKHLDHLSLKGAR----------LTVEQGCHILNSLSYMR 190

  Fly   286 TPINNSDLQCFSAIENLKELLLESPQILHSKQAVAKKNTNGNAT----------DEAASPQPDSL 340
            .....|:|       |:::.......:..|.|......|..|.|          ||.       |
  Rat   191 NENVASEL-------NIEDFFSHHLAVYGSSQFNKAMATFHNLTFLTLNYNCISDEL-------L 241

  Fly   341 KVLSDDEPSTSR 352
            :.||::...|.|
  Rat   242 ETLSENNAGTLR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 9/46 (20%)
leucine-rich repeat 610..635 CDD:275381
Fbxo39NP_001034107.1 F-box-like 16..57 CDD:403981 9/44 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.