DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and FBXL22

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_011519770.1 Gene:FBXL22 / 283807 HGNCID:27537 Length:260 Species:Homo sapiens


Alignment Length:366 Identity:76/366 - (20%)
Similarity:115/366 - (31%) Gaps:139/366 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 PSTSRAAM----EHLRACKVAFNLDNCSDRKEEKSPVPTEPPSEGQDLQAKRIRAPSESDDEDTS 408
            |:..|..|    .||:..|..|             |:.:....:|..|:|:..::||      |:
Human     6 PTALRVGMGLSLGHLQGNKSLF-------------PLTSRRDIQGPQLEARLEQSPS------TA 51

  Fly   409 STSGSSS-DKLEVLSLPR-NGHSNAAPLSGGVDLPPLPHAADAANAADAPIAVDAANIEAPGQSP 471
            ...||:| .|..|..... |.||          |.|.| ..|:|                 |...
Human    52 PLQGSTSRAKQRVKGCGSWNRHS----------LCPQP-PQDSA-----------------GPGS 88

  Fly   472 GLDPRPPRAYIYVPDAENANPRQQRSVVAVFAQGTEQRYIYVNQQFSLPMNVLMPTRRHRTHPRP 536
            ||..|..:.|         .||.......|..:|.::|   .|.          |.|      :|
Human    89 GLPTRGSQGY---------EPRTHADEGTVGCRGRKRR---ENG----------PAR------KP 125

  Fly   537 NYDQVV--QHPMFWNMLEPLDRDYARRVRPRPPSCQTTPQY------YVTDRAMYSFGRADRPVQ 593
            .::..|  |..:|.:.            .|.||.|......      :|||..:           
Human   126 TWNPAVSSQPSVFTSQ------------GPSPPRCPNLASVTLSGCGHVTDDCL----------- 167

  Fly   594 PDVVWIRNINRSPDNKLERLSLRNYHLITNHTLEHLVQCSPNL--VYIDVSGTSITLPAIRRFKI 656
                 .|.:...|  :|..|.|.|...:||.||..:......|  :::|.. .:::...:||.:.
Human   168 -----ARLLRCCP--RLRALRLENCARVTNRTLAAVAADGRALQTLHVDFC-RNVSAAGLRRLRA 224

  Fly   657 SKPKCEVVANHLEEFERLPELETQEEDDTVVVMLQPP-PRA 696
            :.|:..:.|.|  ....||:              ||| |||
Human   225 ACPRLALRAEH--SAAMLPD--------------QPPRPRA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040
leucine-rich repeat 610..635 CDD:275381 8/24 (33%)
FBXL22XP_011519770.1 AMN1 <148..229 CDD:187754 19/99 (19%)
leucine-rich repeat 151..176 CDD:275381 5/42 (12%)
leucine-rich repeat 177..202 CDD:275381 8/24 (33%)
leucine-rich repeat 203..228 CDD:275381 4/25 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153001
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.