DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and FBXW8

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_016874665.1 Gene:FBXW8 / 26259 HGNCID:13597 Length:599 Species:Homo sapiens


Alignment Length:389 Identity:78/389 - (20%)
Similarity:130/389 - (33%) Gaps:108/389 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ETECNLMDFCD-----ELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGI 123
            |.|.|.:.|.|     ||...||||||...:......|..::.:..|...::.:....|.||...
Human   107 ENEMNDVPFFDIQLPYELAINIFQYLDRKELGRCAQVSKTWKVIAEDEVLWYRLCQQEGHLPDSS 171

  Fly   124 LEE------ILGRATEKTHTIK--------------------IC------GPPSSQHVAGEFRQF 156
            :.:      |......|.|.::                    :|      |...:.:.:|:.|.:
Human   172 ISDYSCWKLIFQECRAKEHMLRTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVW 236

  Fly   157 -TQTLSSVFPRVVQLKVLELE------GVSLDFEYIHITEFPATLRR----LKLKDCSVRVGDTP 210
             |:|...|.|      .||.|      |:..:..::.|....|....    |.:.|  :|.|..|
Human   237 DTRTWDYVAP------FLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGFLNIWD--LRTGKYP 293

  Fly   211 KSIF---YSIELHLLDLEDLSI--------------EDNSW-----FE-PYYIMGLSKLPSLRRL 252
            ...|   ..|:...|..:|.::              |:..|     || |..:..|..:|..|| 
Human   294 VHRFEHDARIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEIVPETRR- 357

  Fly   253 SLKGCQALCKFVPYGSMAARFGFQKLESLDLRQT-------PINNSDL---QCFSAIENLKELLL 307
                       .|....||......|::.|..:|       |:...|:   |....::.|..:..
Human   358 -----------YPVAVAAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYE 411

  Fly   308 ESPQILHSKQAVAKKNTNGNA----TDEAASPQPDSLKVLSDDEPSTSRAAMEHLRACKVAFNL 367
            .|..:::|.:|..:....||.    |....|..|.:|.|..:.:   .|..:..||:..:|.:|
Human   412 GSKILVYSLEAGRRLLKLGNVLRDFTCVNLSDSPPNLMVSGNMD---GRVRIHDLRSGNIALSL 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 13/50 (26%)
leucine-rich repeat 610..635 CDD:275381
FBXW8XP_016874665.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.