DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and FBXL2

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001336245.1 Gene:FBXL2 / 25827 HGNCID:13598 Length:454 Species:Homo sapiens


Alignment Length:619 Identity:120/619 - (19%)
Similarity:184/619 - (29%) Gaps:235/619 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGRATEKTHTIK 139
            |||..||.:||..::......|..:..|.||...:..|||.|      ...::.||..|  :..|
Human    18 ELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFN------FQTDVEGRVVE--NISK 74

  Fly   140 ICGPPSSQHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSLDFEYIHITEFPATLRRLKLKDCSV 204
            .||                                                 ..||:|.|:.| :
Human    75 RCG-------------------------------------------------GFLRKLSLRGC-I 89

  Fly   205 RVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSLKGCQALCKFVPYGSM 269
            .|||:....|                            .....::..|:|.||..:.....|.  
Human    90 GVGDSSLKTF----------------------------AQNCRNIEHLNLNGCTKITDSTCYS-- 124

  Fly   270 AARFGFQKLESLDLRQ-TPINNSDLQCFS-AIENLKELLLE-SPQILHSKQAVAKKNTNGNATDE 331
            .:|| ..||:.|||.. ..|.||.|:..| ...||:.|.|. ..||  :|..:           |
Human   125 LSRF-CSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQI--TKDGI-----------E 175

  Fly   332 AASPQPDSLKVL-------SDDEPSTSRAAMEHLR-ACK--VAFNLDNCSDRKEEKSPVPTEPPS 386
            |.......||.|       .:||      |::|:: .|.  |:.||.:||           ....
Human   176 ALVRGCRGLKALLLRGCTQLEDE------ALKHIQNYCHELVSLNLQSCS-----------RITD 223

  Fly   387 EG--------QDLQAKRIRAPSESDDEDTSSTSGSSSDKLEVLSLPRNGHSNAAPLSGGVDLPPL 443
            ||        ..|||..:...|...|...::. |.:..:|::|...|..|...|   |...|...
Human   224 EGVVQICRGCHRLQALCLSGCSNLTDASLTAL-GLNCPRLQILEAARCSHLTDA---GFTLLARN 284

  Fly   444 PHAADAANAADAPIAVDAANIEAPGQSPGLDPRPPRAYIYVPDAENANPRQQRSVVAVFAQGTEQ 508
            .|..:..:..:..:..|:..|:.....|.|.                                  
Human   285 CHELEKMDLEECILITDSTLIQLSIHCPKLQ---------------------------------- 315

  Fly   509 RYIYVNQQFSLPMNVLM---PTRRHRTHPRPNYDQVVQHPMFWNMLEPLDRDYARRVRPRPPSCQ 570
              ..|:..||..:::|.   |:..::.....::.:.:.|                        |:
Human   316 --ALVSLSFSDIIHLLKMKEPSHHNKKLFGFSFCKSLSH------------------------CE 354

  Fly   571 TTPQYYVTDRAMYSFGRADRPVQPDVVWIRNINRSP--DNKLERLSLRNYHLITNHTLEHLVQCS 633
                 .:||..                 |.:::.|.  ..:|..|.|.|..|||:..||||..|.
Human   355 -----LITDDG-----------------ILHLSNSTCGHERLRVLELDNCLLITDVALEHLENCR 397

  Fly   634 --PNLVYIDVSGTSITLPAIRRFKISKPKCEVVA 665
              ..|...|..  .:|...|:|.:...|..:|.|
Human   398 GLERLELYDCQ--QVTRAGIKRMRAQLPHVKVHA 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 12/38 (32%)
leucine-rich repeat 610..635 CDD:275381 12/26 (46%)
FBXL2NP_001336245.1 F-box-like 15..56 CDD:315592 11/37 (30%)
leucine-rich repeat 52..79 CDD:275381 10/83 (12%)
AMN1 <76..223 CDD:332986 50/257 (19%)
leucine-rich repeat 80..99 CDD:275381 8/19 (42%)
leucine-rich repeat 106..131 CDD:275381 7/27 (26%)
leucine-rich repeat 132..157 CDD:275381 9/24 (38%)
leucine-rich repeat 158..183 CDD:275381 8/37 (22%)
AMN1 168..398 CDD:332986 61/345 (18%)
leucine-rich repeat 184..209 CDD:275381 8/30 (27%)
leucine-rich repeat 210..235 CDD:275381 7/35 (20%)
leucine-rich repeat 236..261 CDD:275381 6/25 (24%)
leucine-rich repeat 262..287 CDD:275381 7/27 (26%)
leucine-rich repeat 288..313 CDD:275381 2/24 (8%)
leucine-rich repeat 314..364 CDD:275381 11/131 (8%)
leucine-rich repeat 374..393 CDD:275381 9/18 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153044
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.