DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Lrrc29

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001355337.1 Gene:Lrrc29 / 234684 MGIID:2443262 Length:621 Species:Mus musculus


Alignment Length:432 Identity:91/432 - (21%)
Similarity:143/432 - (33%) Gaps:123/432 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 HCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGRATEKTHTIKICGPPSSQHVAGEFRQFTQ 158
            |..|..|:|.|.         ...|.....|..|||....:|..:..|   :|...:|......:
Mouse    91 HLGPHLESLCLG---------GGSPTEASFLALILGCPVLRTLDLSGC---NSLFTSGTLLAQPE 143

  Fly   159 TLSSVFPRVVQLKVLELEGVS--LDFEYIHITEFPATLRRLKLKDC-------------SVRVGD 208
            |...|...:..|:.|.|.|:.  .|..:.|::....:|.||.|..|             |.:|..
Mouse   144 TAQCVREALSGLRDLNLAGLRDLTDLSFNHLSSCFPSLERLSLAYCHLSFELSPTWGSISPQVSS 208

  Fly   209 TPKSIFYSI---------ELHLLDLEDLSIEDNSW----------FEPYYIMGLSKL-------- 246
            ..:..|:::         .|..|||....:...:.          .|..|:.....|        
Mouse   209 PSQLSFHNLLKFIKERAGTLRALDLSGTGLPPEALQALGQVTGLKLEELYLHSCRDLSSEAVTIL 273

  Fly   247 ----PSLRRLSLKGCQALCKFVPYGS-MAARFGFQKLESLDLRQTP-INNSDLQCFSAIENLKEL 305
                |.|..|.|.||..|..    |: :|...|.:.|..|.|::.. :.::......|:..|:.|
Mouse   274 CRQQPGLTSLDLSGCSDLTD----GALLAVSRGLRHLRHLSLKKLQRLTDAGCAALGALRELQSL 334

  Fly   306 LL---------ESPQILHSKQAVAK-------------KNTNGNATDEAASPQPDSLKVLSDDEP 348
            .:         |..|:|.|.:...:             |:.:..:...|..|   |||||  |..
Mouse   335 DMAECCLVSGRELAQVLGSVRRAPRALTSLRLAYCSSLKDASVLSMIPALGP---SLKVL--DLS 394

  Fly   349 S-------TSRAA---MEHLRACKVAF----------NLDNCSD----------RKEEKSPVPTE 383
            |       |.:|.   :.||...::|:          .|...||          :.:.::|.|.|
Mouse   395 SCMALTNQTMQAICTYLIHLSVLRLAWCKELQDWGLLGLKEPSDEPVLSPQLHQKVDNEAPDPQE 459

  Fly   384 PPSEGQDLQAKRIRAPSESDDEDTSSTSGSSSDKLEVLSLPR 425
            |.||.|......::|..|.|....|..:.:|..|  ||..|:
Mouse   460 PSSEPQGSSLLMLQALQELDLTACSKLTDASLAK--VLQFPQ 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 5/19 (26%)
leucine-rich repeat 610..635 CDD:275381
Lrrc29NP_001355337.1 F-box-like 3..38 CDD:372399
leucine-rich repeat 70..83 CDD:275381
LRR_RI <118..360 CDD:393385 47/248 (19%)
leucine-rich repeat 121..154 CDD:275381 6/35 (17%)
leucine-rich repeat 155..180 CDD:275381 6/24 (25%)
leucine-rich repeat 181..227 CDD:275381 8/45 (18%)
leucine-rich repeat 228..248 CDD:275381 4/19 (21%)
AMN1 240..428 CDD:187754 38/196 (19%)
leucine-rich repeat 254..277 CDD:275381 3/22 (14%)
leucine-rich repeat 280..305 CDD:275381 9/28 (32%)
leucine-rich repeat 306..360 CDD:275381 10/53 (19%)
leucine-rich repeat 331..356 CDD:275381 6/24 (25%)
leucine-rich repeat 361..387 CDD:275381 3/28 (11%)
leucine-rich repeat 388..413 CDD:275381 8/26 (31%)
leucine-rich repeat 414..474 CDD:275381 12/59 (20%)
AMN1 <475..589 CDD:187754 8/27 (30%)
leucine-rich repeat 475..525 CDD:275381 8/27 (30%)
leucine-rich repeat 526..551 CDD:275381
leucine-rich repeat 552..577 CDD:275381
leucine-rich repeat 578..603 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.