DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Fbxl19

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_036008913.1 Gene:Fbxl19 / 233902 MGIID:3039600 Length:696 Species:Mus musculus


Alignment Length:447 Identity:92/447 - (20%)
Similarity:148/447 - (33%) Gaps:132/447 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 PQILHSKQAVAKKNTNGNATDEAASPQPD--SLKVLSDDEPSTSRAAMEHL-RACKVAFNLDNCS 371
            |::|:..||.:..:. |...:....|:|.  |.:..:...||..|..:|.. |.|::   |:...
Mouse   263 PRVLNPSQAFSSCHP-GLPPENWEKPKPPIASAEGPAVPSPSPQREKLERFKRMCQL---LERVP 323

  Fly   372 DRKEEKSPVPTEPPSEGQDLQAKRIRAPSESDDEDTSSTSGSSSDKLEVLSLPRNGHSNAAPLSG 436
            |.....|...::..|.|..|...  .||.|:.: ......|||.:|..     |.|.....|.:|
Mouse   324 DTSSSSSDSDSDSDSSGTSLSED--EAPGEARN-GRRPARGSSGEKEN-----RGGRRAIRPGTG 380

  Fly   437 GVDLP-PLPHAADAANAADAPIAVDAANIEAPGQSPGLDPRPPRAYIYVPDAENANPRQQRSVVA 500
            |..|. ||                          .|...||||:...:|   ....||.......
Mouse   381 GPLLSWPL--------------------------GPAPPPRPPQLERHV---VRPPPRSPEPDTL 416

  Fly   501 VFAQGTEQ-----RYIYVNQQFSLPMNVLMPTRRHRTHPRPNYDQVVQHPMFWNMLEPLDRDYAR 560
            ..|.|::.     .::.|.|... |..:.:..|..||..|..||:     ..|..:     |.:|
Mouse   417 PLAAGSDHPLPRAAWLRVFQHLG-PRELCVCMRVCRTWSRWCYDK-----RLWPRM-----DLSR 470

  Fly   561 RVRPRPPS----CQTTPQ--------------YYVTDR---------------AMYSFGRADRPV 592
            |....||.    .:..|:              .::.:|               ::.:.|.|..|.
Mouse   471 RKSLTPPMLSGVVRRQPRALDLSWTGVSKKQLMWLLNRLQGLQELVLSGCSWLSVSALGSAPLPA 535

  Fly   593 QP--DVVWIRNINRS---------PDNK------------LERLSLRNYHLITNHTLEHLVQCSP 634
            ..  |:.||.::..|         ||.|            :..|.|....| |:.:|..|::.:|
Mouse   536 LRLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLEL-TDASLRLLLRHAP 599

  Fly   635 NLVYIDVSGTS---------ITLPA--IRR--FKISKPKCEVVANH-LEEFERLPEL 677
            .|..:|:|..:         :|.|.  :|.  ..::...|..:.:| |..|.|.|.|
Mouse   600 QLSALDLSHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCPRL 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040
leucine-rich repeat 610..635 CDD:275381 6/24 (25%)
Fbxl19XP_036008913.1 zf-CXXC <52..79 CDD:366873
PHD_FXL19 89..150 CDD:277115
F-box-like 426..467 CDD:403981 10/51 (20%)
AMN1 468..667 CDD:187754 36/190 (19%)
leucine-rich repeat 488..511 CDD:275381 1/22 (5%)
leucine-rich repeat 512..535 CDD:275381 2/22 (9%)
leucine-rich repeat 573..600 CDD:275381 6/27 (22%)
leucine-rich repeat 601..627 CDD:275381 5/25 (20%)
leucine-rich repeat 631..655 CDD:275381 5/23 (22%)
leucine-rich repeat 656..680 CDD:275381 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.