DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5003 and Amn1

DIOPT Version :9

Sequence 1:	NP_651593.1	Gene:	CG5003 / 43344	FlyBaseID:	FBgn0039554	Length:	713	Species:	Drosophila melanogaster
Sequence 2:	NP_001106895.1	Gene:	Amn1 / 232566	MGIID:	2442933	Length:	258	Species:	Mus musculus

Alignment Length:	105	Identity:	26/105 - (24%)
Similarity:	46/105 - (43%)	Gaps:	17/105 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   160 LSSVFPRVVQL----KVLELEGVSLDFEYIHITEFPATL--RRLKLKDCSVRVGDTPKSIFYSIE 218
            ||.|..::::|    .|:.:.....|.:|:     |:.:  |.:|:.....|:.|:..|.....|
Mouse     3 LSGVVSQLLELCLQYLVINISRYISDIKYL-----PSNIKDRLIKIMSIRGRITDSNISEVLHPE 62

  Fly   219 LHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSLKGCQ 258
            :..|||....|.|.:      :..|.|...|:.|:||.|:
Mouse    63 VQRLDLRSCDISDVA------LQHLCKCRKLKALNLKSCR 96

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5003	NP_651593.1	F-box	68..114	CDD:279040
CG5003	NP_651593.1	leucine-rich repeat	610..635	CDD:275381
Amn1	NP_001106895.1	leucine-rich repeat	15..38	CDD:275381	4/27 (15%)
		AMN1	37..257	CDD:187754	18/66 (27%)
		leucine-rich repeat	63..86	CDD:275381	7/28 (25%)
		leucine-rich repeat	87..116	CDD:275381	5/10 (50%)
		leucine-rich repeat	117..142	CDD:275381
		leucine-rich repeat	143..168	CDD:275381
		leucine-rich repeat	169..195	CDD:275381
		leucine-rich repeat	196..221	CDD:275381
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1046098at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010