DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and FBXL7

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_036436.1 Gene:FBXL7 / 23194 HGNCID:13604 Length:491 Species:Homo sapiens


Alignment Length:436 Identity:89/436 - (20%)
Similarity:161/436 - (36%) Gaps:136/436 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GRELAAVPVQPVLPQIPTE-EEPEIKQRKREKEHKESLDRETECNLMDFCDELLFEIFQYLDTSS 88
            |..:|.|...|     ||. ..|.|:...|.::.:.|:||        ..|..:.:||.:|.|:.
Human    82 GETVAMVHSPP-----PTRLTHPLIRLASRPQKEQASIDR--------LPDHSMVQIFSFLPTNQ 133

  Fly    89 ILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMG-------------------ILEEI----LGR 130
            :........|:.||..|.|.:..|.|:...:.:.                   :||.:    ..|
Human   134 LCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRR 198

  Fly   131 ATEK-THTIKICGP-------------------------PSSQH--VAGEFRQFTQTLSSVFPRV 167
            .|:: .:||..|.|                         |:.:|  |:|..:....:|:    |.
Human   199 LTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLT----RE 259

  Fly   168 VQLKVLELEGVSLDFEYIHITE--------------FPATLRRLKLKDCSVRVGDTPKSIFYSIE 218
            ..:|:..|.|..:...|:.:|:              ....|..|.|:.| ||:  |.:.:.|.: 
Human   260 ASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRC-VRL--TDEGLRYLV- 320

  Fly   219 LHLLDLEDLSIEDNSWFEPYYIMGLSKLPS---------------------------LRRLSLKG 256
            ::...:::||:.|..:...:.:..::||.|                           ||.|:.:|
Human   321 IYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARG 385

  Fly   257 CQALCKFVPYGSMAARFGFQKLESLDLRQTP-INNSDLQCFSA-IENLKELLLESPQILHSK--Q 317
            |:.:   ..:|.........||:|||:.:.| ::::.|:|.:. ..|||.|.|:|.:.:..:  |
Human   386 CEGI---TDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQ 447

  Fly   318 AVAKKNTNGNATDEAASPQPDSLKVLSDDEPSTSRAAMEHL-RACK 362
            .||     .|..|         |:.|:..:...|..|:..: |.||
Human   448 IVA-----ANCFD---------LQTLNVQDCEVSVEALRFVKRHCK 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 11/45 (24%)
leucine-rich repeat 610..635 CDD:275381
FBXL7NP_036436.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79
F-box-like 114..157 CDD:372399 12/50 (24%)
leucine-rich repeat 129..151 CDD:275381 5/21 (24%)
leucine-rich repeat 154..187 CDD:275381 2/32 (6%)
LRR 1 170..195 2/24 (8%)
AMN1 <185..366 CDD:187754 33/188 (18%)
leucine-rich repeat 188..213 CDD:275381 7/24 (29%)
LRR 2 196..221 6/24 (25%)
leucine-rich repeat 214..234 CDD:275381 0/19 (0%)
LRR 3 222..247 3/24 (13%)
leucine-rich repeat 240..273 CDD:275381 8/36 (22%)
LRR 4 253..281 6/31 (19%)
leucine-rich repeat 274..299 CDD:275381 2/24 (8%)
LRR 5 282..307 3/24 (13%)
AMN1 297..464 CDD:187754 41/187 (22%)
leucine-rich repeat 300..325 CDD:275381 8/28 (29%)
LRR 6 308..333 7/28 (25%)
leucine-rich repeat 326..351 CDD:275381 5/24 (21%)
LRR 7 334..359 3/24 (13%)
leucine-rich repeat 352..377 CDD:275381 0/24 (0%)
LRR 8 360..385 3/24 (13%)
leucine-rich repeat 378..403 CDD:275381 6/27 (22%)
LRR 9 386..411 7/27 (26%)
leucine-rich repeat 404..429 CDD:275381 7/24 (29%)
LRR 10 412..437 8/24 (33%)
leucine-rich repeat 430..453 CDD:275381 8/27 (30%)
LRR 11 438..463 7/38 (18%)
leucine-rich repeat 456..480 CDD:275381 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.