DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Fbxl21

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001333661.1 Gene:Fbxl21 / 213311 MGIID:2442921 Length:460 Species:Mus musculus


Alignment Length:526 Identity:97/526 - (18%)
Similarity:161/526 - (30%) Gaps:187/526 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 GDTPKSIFYSI--ELHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSLKGCQALCKFVPYGSM 269
            |..|..:...|  .|.|:|....|.....|.|.::|      |.|.|                  
Mouse    69 GTLPHHVILQIFQYLPLIDRARASSVCRRWNEVFHI------PDLWR------------------ 109

  Fly   270 AARFGFQKLESLDLRQTPINNSDLQCFSAIENLKELLLESPQILHSKQAVAKKNTNGNATDEAAS 334
              :|.|:           :|.|....|.:..         |.::   |.:.||:        ||.
Mouse   110 --KFEFE-----------LNQSATSYFKSTH---------PDLI---QQIIKKH--------AAH 141

  Fly   335 PQPDSLKVLSDDEPSTSRAAMEHLRACKVAFNLDNCSDRKEEKSPVPTEPPS------------- 386
            .|..|.||.|..|.:.:        ||.:...|.|||  .:....:.|..||             
Mouse   142 LQYVSFKVDSSTESAEA--------ACDILSQLVNCS--IQTLGLISTAKPSFMNVPKSHFVSAL 196

  Fly   387 -----EGQDLQAKRIRAPSESDDEDTSSTSGSSSDKLEVLSLPRNGHSNAAPLSGGVDLPPLPHA 446
                 ..:.|.:.:|. .:..||........::||.|.:|.                 :...||.
Mouse   197 TVVFVNSKSLSSIKIE-DTPVDDPSLKILVANNSDTLRLLK-----------------MSSCPHV 243

  Fly   447 ADAANAADAPIAVDAANIEAPGQSPGLDPRPPRAYIYVPDAENANPRQQRSVVAVFAQGTEQ--- 508
            :                      |.|:                       ..||...||..:   
Mouse   244 S----------------------SDGI-----------------------LCVADHCQGLRELAL 263

  Fly   509 RYIYVNQQFSLPMNVLMPTRRHRTHPRPNYDQVVQHP--MFWNMLEPLDRDYARRVRPRPPSCQT 571
            .|..::.:..|.::  ..|..:..|.|  .|.|.::|  :.::.::....|...:..||   ...
Mouse   264 NYYILSDEILLALS--SETHVNLEHLR--IDVVSENPGQIKFHSIKKRSWDALIKHSPR---VNV 321

  Fly   572 TPQYYVTDRAMYSFGRADRPVQPDVVWIRNINRSPDNKLERLSLRNYHLITNHTLEHLVQCSPNL 636
            ...:::.:....:|.:.:.|| ..:.:.|:::|:   .|.|:.|....||      .||.|:..|
Mouse   322 VMYFFLYEEEFEAFFKEETPV-THLYFGRSVSRA---ILGRIGLNCPRLI------ELVVCANGL 376

  Fly   637 VYIDVSGTSITLPAIRRFKISKPKCEVVANHLEEF-----ERLPELETQEEDDTVVVMLQPPPRA 696
            :.:|.....|.........:...:|||..:...||     .||.:|...||      :|.|    
Mouse   377 LPLDSELIRIAKHCKNLTSLGLSECEVSCSAFVEFVRLCGRRLTQLSIMEE------VLVP---- 431

  Fly   697 DDEQPP 702
            ||...|
Mouse   432 DDRYTP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040
leucine-rich repeat 610..635 CDD:275381 8/24 (33%)
Fbxl21NP_001333661.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843152
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.