DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and AMN1

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001106873.1 Gene:AMN1 / 196394 HGNCID:27281 Length:258 Species:Homo sapiens


Alignment Length:150 Identity:33/150 - (22%)
Similarity:50/150 - (33%) Gaps:54/150 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 RRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKLPSLRRLSL---KG 256
            |.:|:.....::.|:..|.....|:..|||....|.|.:      ::.||....|::|:|   ||
Human    39 RLIKIMSMQGQITDSNISEILHPEVQTLDLRSCDISDAA------LLHLSNCRKLKKLNLNASKG 97

  Fly   257 ----------------CQAL--------CKFVPYGSMAARFGFQKLESLDL-------------- 283
                            |..|        |.....|.:|.....|.|:.:||              
Human    98 NRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHAL 162

  Fly   284 -RQTPINNSDLQC--FSAIE 300
             :..|.    |||  |||.:
Human   163 GKNCPF----LQCVDFSATQ 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040
leucine-rich repeat 610..635 CDD:275381
AMN1NP_001106873.1 AMN1 37..257 CDD:187754 33/149 (22%)
leucine-rich repeat 63..86 CDD:275381 7/28 (25%)
leucine-rich repeat 87..116 CDD:275381 6/28 (21%)
leucine-rich repeat 117..142 CDD:275381 4/24 (17%)
leucine-rich repeat 143..168 CDD:275381 3/24 (13%)
leucine-rich repeat 169..195 CDD:275381 6/9 (67%)
leucine-rich repeat 196..221 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.