DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and T28B4.1

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001024931.1 Gene:T28B4.1 / 180930 WormBaseID:WBGene00020884 Length:552 Species:Caenorhabditis elegans


Alignment Length:476 Identity:99/476 - (20%)
Similarity:157/476 - (32%) Gaps:195/476 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EQAELGSTCLAAPKRRFPDNERCG----------RELAAVPVQPVLPQIPTEEEPEIKQRKREKE 56
            |.|...|....|.|:.|.|.|...          |.|:.:.:..||.::||.|:           
 Worm    15 EHASTSSNTWLAKKKHFRDTEEWKVKKTRILNKLRALSKINLALVLSRMPTIEK----------- 68

  Fly    57 HKESLDRETECNLMDFCDELLFEIFQYLDTSSILAVMHCSPRF----ENLLLDHRF------YHH 111
                           ..|::|.:|||||....|..|.....|:    :|.|| .:|      |..
 Worm    69 ---------------LPDKVLRDIFQYLSPKQINQVGLVCKRWRVTSQNPLL-WKFVSFRPNYGG 117

  Fly   112 IDLSNGPLPMGILEEILGRATEKTHTIKICGPPSSQHVAGEFRQFTQTLSSVFPRVV-QL--KVL 173
            |.::    |..|           .|.|::.|...|     |.|........:.|.|: :|  |..
 Worm   118 IQVN----PQCI-----------DHFIQLIGTRFS-----ELRIVELATDLITPNVLYELANKAP 162

  Fly   174 ELEGVSLDF-------EYIHITEFPATLRRLKLKDCSVRVGDTPKSIFY------------SIE- 218
            :|:.::|||       ::..:..||:.|:.|.|  |      ..::||.            |:| 
 Worm   163 KLQYLTLDFSTAMQLHDFTDLQSFPSRLKSLTL--C------LSENIFLEGFLRKVYTFISSVET 219

  Fly   219 LHLL-DLEDLSIEDNSWFEPYYIMGLSK-LPSLRRLSLKG---------------CQAL-CKFVP 265
            ||:: ..|.:..|:...:|...:..|.: ||:||.::|.|               |..| |..|.
 Worm   220 LHIIGTYEKVEDEEEEVYETVNVFKLKQFLPNLRVVNLWGVPFITDEHVDAISSNCAHLECLCVN 284

  Fly   266 Y------------------------------GSMAARFGFQK--LESLDLRQTPINNSDLQCFSA 298
            |                              .::.....::|  :|.||::.|.:|:..|  .|.
 Worm   285 YCPKVTGSCLKLVLQRCRKLKTLFLAHTKLDNNIVKMVDWEKTRIEELDIKGTELNSDAL--ISI 347

  Fly   299 IENLKEL------LLE--SPQILHSKQAVAKKNTNGNATDEAASPQPDSLKVLSDDEPSTSRAAM 355
            :..|..|      .||  :.|:|.:.|       |.||.        .||:.|            
 Worm   348 LTRLPHLRWLDASWLECMTDQVLEAWQ-------NSNAM--------GSLQFL------------ 385

  Fly   356 EHLRACKVAFNLDNCSDRKEE 376
                      |:|.|....|:
 Worm   386 ----------NMDTCDSINEQ 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 16/55 (29%)
leucine-rich repeat 610..635 CDD:275381
T28B4.1NP_001024931.1 F-box-like 66..110 CDD:372399 15/70 (21%)
leucine-rich repeat 139..163 CDD:275381 5/23 (22%)
leucine-rich repeat 164..189 CDD:275381 6/24 (25%)
leucine-rich repeat 190..208 CDD:275381 6/25 (24%)
AMN1 <244..358 CDD:187754 22/115 (19%)
leucine-rich repeat 252..277 CDD:275381 5/24 (21%)
leucine-rich repeat 278..303 CDD:275381 4/24 (17%)
leucine-rich repeat 304..353 CDD:275381 9/50 (18%)
leucine-rich repeat 354..381 CDD:275381 9/41 (22%)
leucine-rich repeat 382..431 CDD:275381 6/37 (16%)
leucine-rich repeat 432..469 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5688
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.