Sequence 1: | NP_651593.1 | Gene: | CG5003 / 43344 | FlyBaseID: | FBgn0039554 | Length: | 713 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741137.1 | Gene: | skpt-1 / 175749 | WormBaseID: | WBGene00018613 | Length: | 421 | Species: | Caenorhabditis elegans |
Alignment Length: | 303 | Identity: | 63/303 - (20%) |
---|---|---|---|
Similarity: | 98/303 - (32%) | Gaps: | 108/303 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 EPEIKQRKREKEHKESLDRETECNLMDFCDELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFY 109
Fly 110 ---HH------IDLSNGPLPMGILEEI--LGRATEKTHTIKICGPPSSQHVAGEFRQFTQTL--- 160
Fly 161 ----------SSVFPRVVQ--------LKVLELEGVSLDFEYIHITEFPATLRRLKLKDCSVRVG 207
Fly 208 DTPKS----------------------------IFYSI--ELHLLDLE----------------- 225
Fly 226 -------DLSIEDN-SWFEPYYIMGLSKLPSLRRLSLKGCQAL 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5003 | NP_651593.1 | F-box | 68..114 | CDD:279040 | 13/54 (24%) |
leucine-rich repeat | 610..635 | CDD:275381 | |||
skpt-1 | NP_741137.1 | F-box-like | 92..130 | CDD:372399 | 13/46 (28%) |
AMN1 | 150..373 | CDD:187754 | 40/205 (20%) | ||
leucine-rich repeat | 153..183 | CDD:275381 | 3/29 (10%) | ||
leucine-rich repeat | 184..208 | CDD:275381 | 2/23 (9%) | ||
leucine-rich repeat | 209..232 | CDD:275381 | 9/25 (36%) | ||
leucine-rich repeat | 233..258 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 259..284 | CDD:275381 | 3/24 (13%) | ||
leucine-rich repeat | 285..313 | CDD:275381 | 3/27 (11%) | ||
leucine-rich repeat | 314..339 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 340..362 | CDD:275381 | 5/12 (42%) | ||
leucine-rich repeat | 365..388 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR16134 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |