DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and skpt-1

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_741137.1 Gene:skpt-1 / 175749 WormBaseID:WBGene00018613 Length:421 Species:Caenorhabditis elegans


Alignment Length:303 Identity:63/303 - (20%)
Similarity:98/303 - (32%) Gaps:108/303 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EPEIKQRKREKEHKESLDRETECNLMDFCDELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFY 109
            |.||...||    |::...:.........||:..:||..|....:|:.|         |:.||||
 Worm    70 EDEIAPIKR----KDARSIQNPFKKYSIPDEITEQIFSNLKKKDLLSAM---------LVCHRFY 121

  Fly   110 ---HH------IDLSNGPLPMGILEEI--LGRATEKTHTIKICGPPSSQHVAGEFRQFTQTL--- 160
               |.      .|..:.|     :.||  :..:..|...:::.|..:.:.:..:.|.....|   
 Worm   122 GIGHKSRNWIITDAQDRP-----ISEISLIALSQRKIKVLRLAGAKADRILRADERLVEVALLST 181

  Fly   161 ----------SSVFPRVVQ--------LKVLELEGVSLDFEYIHITEFPATLRRLKLKDCSVRVG 207
                      :::..|.:|        ||.|.:||..||   .|:....|..|.|:..|.|:..|
 Worm   182 SRLELLDLSRTNLTARQMQIMLKPCQKLKCLSIEGNQLD---DHVAICIAENRGLRELDISMTNG 243

  Fly   208 DTPKS----------------------------IFYSI--ELHLLDLE----------------- 225
            .|...                            |.:||  :|..|:|.                 
 Worm   244 ITANGASLIFRNCKDLQQLNLAWCGLTQPIVTVIIHSIGEKLKKLNLSGTVRNFGINNKHIEILA 308

  Fly   226 -------DLSIEDN-SWFEPYYIMGLSKLPSLRRLSLKGCQAL 260
                   ||.:.|| ...:|...:.|:|.|.|..:||..|..|
 Worm   309 AKSNYVTDLDLSDNVEISDPGLAVILNKFPRLTTISLNRCYGL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 13/54 (24%)
leucine-rich repeat 610..635 CDD:275381
skpt-1NP_741137.1 F-box-like 92..130 CDD:372399 13/46 (28%)
AMN1 150..373 CDD:187754 40/205 (20%)
leucine-rich repeat 153..183 CDD:275381 3/29 (10%)
leucine-rich repeat 184..208 CDD:275381 2/23 (9%)
leucine-rich repeat 209..232 CDD:275381 9/25 (36%)
leucine-rich repeat 233..258 CDD:275381 5/24 (21%)
leucine-rich repeat 259..284 CDD:275381 3/24 (13%)
leucine-rich repeat 285..313 CDD:275381 3/27 (11%)
leucine-rich repeat 314..339 CDD:275381 7/24 (29%)
leucine-rich repeat 340..362 CDD:275381 5/12 (42%)
leucine-rich repeat 365..388 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.