DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and FBXO39

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_694962.1 Gene:FBXO39 / 162517 HGNCID:28565 Length:442 Species:Homo sapiens


Alignment Length:235 Identity:50/235 - (21%)
Similarity:85/235 - (36%) Gaps:94/235 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 QYLDTSSILAVMHCSPRFENLL----LDHRFYHHIDLSNGPLPMGILEEILGRATEKTHTIKICG 142
            |.||:.|.:       |.||::    ::..|.||:.:.|.|                        
Human   181 QILDSLSYM-------RNENVISELNIEDYFSHHLAVYNSP------------------------ 214

  Fly   143 PPSSQHVAGEFRQFTQTLSSVFPRVVQLKVLELEGVSLDFEYI------HITEFPATLRRLKLKD 201
                        ||.:|:|: |..:|.|        :|::..|      ::.|..:|||.:.:| 
Human   215 ------------QFKKTMST-FHNLVSL--------NLNYNCISDELLENLCENASTLRTINIK- 257

  Fly   202 CSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFE---PYYIMG---LSKLPSLRRLSLKGC--- 257
            |.|.  |....:.:.:....|..:..:::.|.:||   .|..:.   |.::| :|.:||:.|   
Human   258 CHVH--DPHGQVIWGMSWAKLARQATNLKVNFFFERIMKYERLARILLQEIP-IRSISLRSCYFS 319

  Fly   258 -------QALCKFVPYGSMAARFGFQKL--------ESLD 282
                   ..|...:|    ..|...|||        ||||
Human   320 DPDCSMRPTLIDLLP----TFRHTLQKLTCEFNNNHESLD 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 10/35 (29%)
leucine-rich repeat 610..635 CDD:275381
FBXO39NP_694962.1 F-box-like 16..57 CDD:289689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.