DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and CG44004

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001262004.2 Gene:CG44004 / 14462879 FlyBaseID:FBgn0264746 Length:368 Species:Drosophila melanogaster


Alignment Length:292 Identity:60/292 - (20%)
Similarity:99/292 - (33%) Gaps:74/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SSILAVMHCSPRFENLLLDHR--FYHHIDLSNGPLPMGILEEILGRATEKTHTIKICGPPSSQHV 149
            |.:|.:..|....|.|:.|..  |::.|          ::|.:....|.......:.....|..:
  Fly    63 SFLLVIQECGHTTEELVFDRSCDFWNDI----------LIEAVTKYCTNLKSFTAVLYRSDSDQI 117

  Fly   150 AGEFRQFTQTLSSVFPRVVQLKVLELEGVS-LDFEYIHITEFPATLRRLKLKD-CSVRVGDTPKS 212
            ....|:..:.|.|          |.||..| ..||.:.:......|:.|.:|. ....|.:..| 
  Fly   118 CSFLRKINKLLLS----------LSLEQRSRFPFEILKVVGEMTQLKELSVKGYIDENVNEIQK- 171

  Fly   213 IFYSIELHLLDLEDLSIEDNSWFEPYY-------IMGL-SKLPSLRRLSLKGCQALCKFVPYGSM 269
                    |:.||.|:||.:     ||       |:.: |.|.:||:|::.....:....|:..|
  Fly   172 --------LVALEKLNIEQH-----YYLDKPDVNILRICSSLSNLRKLTINNVHIISCEEPHSKM 223

  Fly   270 AARFGFQKLESLDLRQTPINNSDLQCFSAIENLKELLLESPQILHSKQA-----VAKKNTNGNAT 329
            .|     .||:|.|....:......|    .|||  :|:...:.:|.:.     :.|...|....
  Fly   224 WA-----DLETLKLIICALTPELPDC----PNLK--VLDIHYLRNSNEGYILKFILKNGRNLKTL 277

  Fly   330 DEAASPQPDSLKVLSDDEPSTSRAAMEHLRAC 361
            .|...|            |..:...::.||.|
  Fly   278 YERCHP------------PIDANGFLQLLRGC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 8/28 (29%)
leucine-rich repeat 610..635 CDD:275381
CG44004NP_001262004.2 leucine-rich repeat 75..101 CDD:275381 6/35 (17%)
leucine-rich repeat 121..152 CDD:275381 9/40 (23%)
leucine-rich repeat 153..172 CDD:275381 5/27 (19%)
leucine-rich repeat 175..202 CDD:275381 10/31 (32%)
leucine-rich repeat 203..226 CDD:275381 6/27 (22%)
leucine-rich repeat 247..273 CDD:275381 5/27 (19%)
leucine-rich repeat 274..299 CDD:275381 6/36 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR16134
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.