DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and Ppa

DIOPT Version :10

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_061513870.1 Gene:Ppa / 1279716 VectorBaseID:AGAMI1_003831 Length:499 Species:Anopheles gambiae


Alignment Length:52 Identity:13/52 - (25%)
Similarity:22/52 - (42%) Gaps:4/52 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PRTPQ-QIAAQKRLQQTQAQVDEVVDIMKTNVE---KVLERDQKLSELDDRA 73
            |:|.: ::|......||........|:...:||   .|:|...|.|.:..|:
Mosquito    92 PKTSELRVAHDAPTFQTTYSYSISWDVEMDDVEHYRNVMETVSKSSAISSRS 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 69..111 CDD:425796 1/5 (20%)
leucine-rich repeat 610..635 CDD:275381
PpaXP_061513870.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.