DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and AT4G05475

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_001190683.1 Gene:AT4G05475 / 10723048 AraportID:AT4G05475 Length:309 Species:Arabidopsis thaliana


Alignment Length:304 Identity:67/304 - (22%)
Similarity:106/304 - (34%) Gaps:79/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EEEPEIKQRKREKEHKESLDRETECNLMDFCDELLFEIFQYLDTSSIL--AVMHC--------SP 97
            |:|.:..:|:.........|.|...|.:|...||...|...|..:.||  |...|        .|
plant    14 EDEEQRNKRRTTSTMFLKKDDEERINWVDLPPELTTSILLRLSVTDILDNARKLCRAWRRICKDP 78

  Fly    98 RF-------ENLLLDHRF----YHHIDLSNGPLPMGILE---------EILGRATEKTHTIKICG 142
            ..       :.|:.:..|    .|.:|||.|    |:||         .:|....:::..:|..|
plant    79 SMWRKINLRDCLMYEFDFESMCRHIVDLSQG----GLLEINIEHFVSDSLLSYIVDRSCNLKSLG 139

  Fly   143 PPSSQHVAGEFRQFTQTLSSVFPRVVQLKVLEL-----EGVSLDFEYI-HITEFPATLRRLKLKD 201
            ....:         ..|...|...:.:|.:||.     ..:.||.:.| |..   ..|:.|||..
plant   140 ISIYE---------PMTNKGVMNGIEKLPLLETLVIFHSSIKLDLKAIGHAC---PQLKTLKLNS 192

  Fly   202 CSVRVGDTPKSIFYSIELHLLDLED--LSIEDNSWFEPYYIMGLSKLPSLRRLSLKGCQALCKFV 264
            ....:......:.|   :.||:.:|  |:|.::             :|.||.|.|.| ..|..  
plant   193 LGSELAHDISQVGY---IPLLECDDDALAIAES-------------MPKLRHLQLMG-NGLTN-- 238

  Fly   265 PYGSMAARFGFQKLES-LDLRQ----TPINNSDLQCFSAIENLK 303
             .|..|...|...||. ||:|:    ..:.|.:.:|...|:.|:
plant   239 -TGLNAILDGCPHLEEHLDVRKCFNINLVGNLEKRCMKRIKELR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 14/66 (21%)
leucine-rich repeat 610..635 CDD:275381
AT4G05475NP_001190683.1 F-box-like 40..87 CDD:289689 10/46 (22%)
leucine-rich repeat 81..111 CDD:275381 7/33 (21%)
leucine-rich repeat 112..134 CDD:275381 3/21 (14%)
leucine-rich repeat 135..160 CDD:275381 5/33 (15%)
leucine-rich repeat 161..184 CDD:275381 6/25 (24%)
leucine-rich repeat 185..206 CDD:275381 4/20 (20%)
leucine-rich repeat 226..250 CDD:275381 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.