DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and fbxl18

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_002931545.1 Gene:fbxl18 / 100492578 XenbaseID:XB-GENE-980052 Length:692 Species:Xenopus tropicalis


Alignment Length:568 Identity:118/568 - (20%)
Similarity:191/568 - (33%) Gaps:211/568 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NLMDFCDELLFEIFQYL-DTSSILAVMHCSPRFENLLLD---------HRFYH------------ 110
            |.::..||:|..|..|: .|..||.|.....:...|.||         |:.|.            
 Frog     2 NPIELSDEILLHILSYVPSTDLILNVKRTCHKLAGLCLDKSLIQKVILHKEYQASDNQVKQLLRE 66

  Fly   111 -------------------------------HIDLSNGPLPMGILEEILGRATEKTHTIKIC--- 141
                                           .:|||..||....|.::|      |...::|   
 Frog    67 AGKEIRELDMSGCYWLSSSTVDLIAQCKRLVRLDLSGCPLTSLRLSKLL------TDLHQLCSLS 125

  Fly   142 -----GPPSSQ----------HVAGEFRQFTQTLSS----VFPRVVQLKVLEL---------EGV 178
                 |..|.|          ||    |:..|||.:    |.|..:.|:.|.|         ||.
 Frog   126 IDIGAGFDSGQLTTECKATLRHV----RELKQTLFAPSYGVVPCCINLEKLLLYFEVLDRTREGT 186

  Fly   179 SLDFE----------YIHITEFPATLR---------RLKLKDCSVRVGDTPKSIFYSI------- 217
            .:..:          |.::..|.|.|.         ||.|...:.|..:..::...|:       
 Frog   187 VMSGQLMVGESKIPHYQNLRLFYARLAPGYINEEVVRLYLTVLTDRTPENLRAFLISVPGSLAES 251

  Fly   218 --ELHLLD--LEDLSIE----DNSWF------------EPYYIMGLSKLPSLRRLSLKGCQALCK 262
              ..:|||  .:::|:|    ..||.            .|:|:       |..|..:.|.| |.:
 Frog   252 SASKNLLDSMAKNVSLEAFQLPKSWLSGSSLLQNLKFSSPFYL-------SFSRSMISGGQ-LTQ 308

  Fly   263 FVPYGSMAARFGFQKLESLDLRQTPIN-NSDLQCFSAIEN-----LKELLLESPQILHSKQAVAK 321
            :|..|.|..|    .|.||:||..|.: ||||.....:|:     |:.|:...|.:.|...:.|.
 Frog   309 WVINGHMDCR----SLVSLNLRGCPFSLNSDLPFRKTVEDIDCNILETLVTACPNLAHLNLSYAH 369

  Fly   322 KNTNGNATDEAASPQPDSLKVLSDDEPSTSRAAMEHLRA-----CKVAFNLDNCSDRKEEKSPVP 381
            .:::.:||....    |.|            |.::|||:     |.:. |..|.:|:...:.|..
 Frog   370 HHSSESATRHLC----DIL------------AQLKHLRSLSLPVCAIV-NTSNTTDKSLIQCPGQ 417

  Fly   382 TEPPSEGQDLQAKRIRAPSESD-----DEDTSSTSGSSSD----KLEVL------SLPRNGHS-- 429
            :.|.:..... .|::|...:::     |:::|.......:    .||::      ::|||..:  
 Frog   418 STPRTATLGF-GKKVRIGVQTNSMTLPDQNSSFWKLLKENPFIVNLELIGSNFYSAMPRNDPAIR 481

  Fly   430 NAAPLSGGVDLPP--LPHA---ADAANAADAPIAVDAANIEAPGQSPG 472
            ||        .||  |.|:   |..||.:......:....:.||...|
 Frog   482 NA--------YPPCALSHSVGDAQIANISQLEFLQNLTLAQLPGIHTG 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 15/98 (15%)
leucine-rich repeat 610..635 CDD:275381
fbxl18XP_002931545.1 F-box-like 8..43 CDD:372399 12/34 (35%)
leucine-rich repeat 18..43 CDD:275381 7/24 (29%)
leucine-rich repeat 44..68 CDD:275381 2/23 (9%)
leucine-rich repeat 71..95 CDD:275381 0/23 (0%)
leucine-rich repeat 96..120 CDD:275381 8/29 (28%)
leucine-rich repeat 320..359 CDD:275381 13/38 (34%)
leucine-rich repeat 360..389 CDD:275381 7/44 (16%)
leucine-rich repeat 459..506 CDD:275381 14/54 (26%)
leucine-rich repeat 507..533 CDD:275381 3/15 (20%)
leucine-rich repeat 534..563 CDD:275381
leucine-rich repeat 564..589 CDD:275381
leucine-rich repeat 590..616 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16134
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.