| Sequence 1: | NP_651593.1 | Gene: | CG5003 / 43344 | FlyBaseID: | FBgn0039554 | Length: | 713 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_004918731.1 | Gene: | fbxl20 / 100491064 | XenbaseID: | XB-GENE-979487 | Length: | 516 | Species: | Xenopus tropicalis |
| Alignment Length: | 422 | Identity: | 99/422 - (23%) |
|---|---|---|---|
| Similarity: | 149/422 - (35%) | Gaps: | 128/422 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 75 ELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGRATEKTHTIK 139
Fly 140 ICG----PPSSQHVAG----EFRQFTQTLSSVFPRVVQLKVLELEGVS--LDFEYIHITEFPATL 194
Fly 195 RRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKL----PSLRRLSLK 255
Fly 256 GCQAL----CKFVPYGSMAARF----------------------GFQKLESL------DLRQTPI 288
Fly 289 NN-------------------SDLQCFSAIENLKEL----LLESPQILHS----------KQAVA 320
Fly 321 KKNTNGNATDEA------ASPQPDSLKVLS-DDEPSTSRAAMEHLRACK--VAFNLDNC-----S 371
Fly 372 DRKEEKSPVP-----------TEPPSEGQDLQ 392 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5003 | NP_651593.1 | F-box | 68..114 | CDD:279040 | 12/38 (32%) |
| leucine-rich repeat | 610..635 | CDD:275381 | |||
| fbxl20 | XP_004918731.1 | F-box-like | 107..149 | CDD:289689 | 12/38 (32%) |
| leucine-rich repeat | 144..171 | CDD:275381 | 10/34 (29%) | ||
| AMN1 | 172..369 | CDD:187754 | 45/212 (21%) | ||
| leucine-rich repeat | 172..197 | CDD:275381 | 5/24 (21%) | ||
| leucine-rich repeat | 198..220 | CDD:275381 | 5/28 (18%) | ||
| leucine-rich repeat | 224..249 | CDD:275381 | 7/28 (25%) | ||
| leucine-rich repeat | 250..275 | CDD:275381 | 8/27 (30%) | ||
| leucine-rich repeat | 276..301 | CDD:275381 | 13/26 (50%) | ||
| AMN1 | 299..474 | CDD:187754 | 31/174 (18%) | ||
| leucine-rich repeat | 302..328 | CDD:275381 | 1/25 (4%) | ||
| leucine-rich repeat | 329..354 | CDD:275381 | 4/24 (17%) | ||
| leucine-rich repeat | 355..380 | CDD:275381 | 3/24 (13%) | ||
| leucine-rich repeat | 381..406 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 407..429 | CDD:275381 | 3/21 (14%) | ||
| leucine-rich repeat | 436..455 | CDD:275381 | 6/18 (33%) | ||
| leucine-rich repeat | 461..486 | CDD:275381 | 3/24 (13%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1046098at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||