DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5003 and fbxl20

DIOPT Version :9

Sequence 1:NP_651593.1 Gene:CG5003 / 43344 FlyBaseID:FBgn0039554 Length:713 Species:Drosophila melanogaster
Sequence 2:XP_002664757.2 Gene:fbxl20 / 100331130 ZFINID:ZDB-GENE-081031-27 Length:436 Species:Danio rerio


Alignment Length:435 Identity:89/435 - (20%)
Similarity:143/435 - (32%) Gaps:155/435 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGRATEKTHTIK 139
            |||..||.:||..::......|..:..|.||...:..|||      .....:|.||..|  :..|
Zfish    31 ELLLRIFSFLDVVTLCRCAQVSRSWNVLALDGSNWQRIDL------FDFQRDIEGRVVE--NISK 87

  Fly   140 ICG----PPSSQHVAG----EFRQFTQTLSSVFPRVVQLKVLELEGVS--LDFEYIHITEFPATL 194
            .||    ..|.:...|    ..|.|.|...::       ::|.|.|.:  .|.....:::|...|
Zfish    88 RCGGFLRKLSLRGCLGVGDSALRTFAQNCRNI-------ELLSLNGCTKITDSTCNSLSKFCPKL 145

  Fly   195 RRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKL----PSLRRLSLK 255
            :.|.|..|:.....:.|::.....|    ||.|:|   ||.:.....|:..|    |.|:.|.||
Zfish   146 KHLDLASCTSITNLSLKALSEGCPL----LEQLNI---SWCDQVTKDGIQALVRCCPGLKGLFLK 203

  Fly   256 GC-----------------------QALCKFVPYGSMAARFGFQKLESLDLRQTPINNSDLQCFS 297
            ||                       |...:....|.:....|..:|:||             |.|
Zfish   204 GCTQLEDEALKHIGGHCPELVTLNLQTCSQITDEGLITICRGCHRLQSL-------------CVS 255

  Fly   298 AIENLKELLLES-----PQILHSKQAVAKKNTNGNATDEAAS----------------------- 334
            ...|:.:.:|.:     |::...:.|...:.|:...|..|.:                       
Zfish   256 GCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTSLARNCHELEKMDLEECVQITDATLIQL 320

  Fly   335 ----PQ--------------------------PDSLKVLS-DDEPSTSRAAMEHLRACKVAFNLD 368
                |:                          .|.|:|:. |:.|..:.|::|||::|   .:||
Zfish   321 SIHCPRLQVLSLSHCELITDDGIRQLGSGPCAHDRLEVIELDNCPLITDASLEHLKSC---HSLD 382

  Fly   369 -----NC-----SDRKEEKSPVP-----------TEPPSEGQDLQ 392
                 :|     :..|..::.:|           |.|||.|...|
Zfish   383 RIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSRQ 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5003NP_651593.1 F-box 68..114 CDD:279040 12/38 (32%)
leucine-rich repeat 610..635 CDD:275381
fbxl20XP_002664757.2 F-box-like 28..70 CDD:289689 12/38 (32%)
leucine-rich repeat 65..92 CDD:275381 10/34 (29%)
AMN1 93..289 CDD:187754 44/222 (20%)
leucine-rich repeat 93..112 CDD:275381 3/18 (17%)
leucine-rich repeat 119..132 CDD:275381 3/19 (16%)
leucine-rich repeat 145..170 CDD:275381 5/24 (21%)
leucine-rich repeat 171..196 CDD:275381 8/27 (30%)
leucine-rich repeat 197..222 CDD:275381 6/24 (25%)
AMN1 206..394 CDD:187754 29/203 (14%)
leucine-rich repeat 223..248 CDD:275381 3/24 (13%)
leucine-rich repeat 249..274 CDD:275381 7/37 (19%)
leucine-rich repeat 275..300 CDD:275381 4/24 (17%)
leucine-rich repeat 301..326 CDD:275381 0/24 (0%)
leucine-rich repeat 327..349 CDD:275381 0/21 (0%)
leucine-rich repeat 356..380 CDD:275381 9/26 (35%)
leucine-rich repeat 381..406 CDD:275381 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588066
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1046098at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.