Sequence 1: | NP_651593.1 | Gene: | CG5003 / 43344 | FlyBaseID: | FBgn0039554 | Length: | 713 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002664757.2 | Gene: | fbxl20 / 100331130 | ZFINID: | ZDB-GENE-081031-27 | Length: | 436 | Species: | Danio rerio |
Alignment Length: | 435 | Identity: | 89/435 - (20%) |
---|---|---|---|
Similarity: | 143/435 - (32%) | Gaps: | 155/435 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 ELLFEIFQYLDTSSILAVMHCSPRFENLLLDHRFYHHIDLSNGPLPMGILEEILGRATEKTHTIK 139
Fly 140 ICG----PPSSQHVAG----EFRQFTQTLSSVFPRVVQLKVLELEGVS--LDFEYIHITEFPATL 194
Fly 195 RRLKLKDCSVRVGDTPKSIFYSIELHLLDLEDLSIEDNSWFEPYYIMGLSKL----PSLRRLSLK 255
Fly 256 GC-----------------------QALCKFVPYGSMAARFGFQKLESLDLRQTPINNSDLQCFS 297
Fly 298 AIENLKELLLES-----PQILHSKQAVAKKNTNGNATDEAAS----------------------- 334
Fly 335 ----PQ--------------------------PDSLKVLS-DDEPSTSRAAMEHLRACKVAFNLD 368
Fly 369 -----NC-----SDRKEEKSPVP-----------TEPPSEGQDLQ 392 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5003 | NP_651593.1 | F-box | 68..114 | CDD:279040 | 12/38 (32%) |
leucine-rich repeat | 610..635 | CDD:275381 | |||
fbxl20 | XP_002664757.2 | F-box-like | 28..70 | CDD:289689 | 12/38 (32%) |
leucine-rich repeat | 65..92 | CDD:275381 | 10/34 (29%) | ||
AMN1 | 93..289 | CDD:187754 | 44/222 (20%) | ||
leucine-rich repeat | 93..112 | CDD:275381 | 3/18 (17%) | ||
leucine-rich repeat | 119..132 | CDD:275381 | 3/19 (16%) | ||
leucine-rich repeat | 145..170 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 171..196 | CDD:275381 | 8/27 (30%) | ||
leucine-rich repeat | 197..222 | CDD:275381 | 6/24 (25%) | ||
AMN1 | 206..394 | CDD:187754 | 29/203 (14%) | ||
leucine-rich repeat | 223..248 | CDD:275381 | 3/24 (13%) | ||
leucine-rich repeat | 249..274 | CDD:275381 | 7/37 (19%) | ||
leucine-rich repeat | 275..300 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 301..326 | CDD:275381 | 0/24 (0%) | ||
leucine-rich repeat | 327..349 | CDD:275381 | 0/21 (0%) | ||
leucine-rich repeat | 356..380 | CDD:275381 | 9/26 (35%) | ||
leucine-rich repeat | 381..406 | CDD:275381 | 4/24 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170588066 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1046098at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.850 |